(data stored in ACNUC7421 zone)

EMBL: CP001720.PE189

CP001720.PE189       Location/Qualifiers
FT   CDS_pept        219699..220661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0201"
FT                   /product="4-diphosphocytidyl-2C-methyl-D-erythritolkinase"
FT                   /EC_number="2.7.1.148"
FT                   /note="KEGG: baa:BA_0633 4-diphosphocytidyl-2-C-methyl-D-
FT                   erythritol kinase; TIGRFAM:
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol kinase; PFAM:
FT                   GHMP kinase; GHMP kinase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61154"
FT                   /db_xref="GOA:C8W2Z8"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2Z8"
FT                   /inference="protein motif:TFAM:TIGR00154"
FT                   /protein_id="ACV61154.1"
FT                   /translation="MPLVIPAYAKINLCLDVLGRRDDGYHEVEMVMQSISLHDLLELSL
FT                   SEEQENNNMGKIILTVAGADLPVGEENLVFRTARILQEYTGCRLGCSILLHKKIPVAAG
FT                   LAGGSADAAAALLGLNKLWNLDLTVAELYALAAKIGSDVPFCIKGGTVLAKGRGEQLAF
FT                   LEAAPDMGIILVKPAYGISTGEVYSKLNSAVYPQVINTMQKKDITNDTNDIHNMLCLSD
FT                   LGPPVLRMIKAIKSRQLPAVCKALYNILEEPAMKMHPNLLDIKNILFEQGAMGVLMSGS
FT                   GSTIFGITPDLEAAHLLSKGLSPSLGSIYAVKLQGAREV"
     atgcctttgg ttatacccgc ttatgctaaa atcaatcttt gtttggatgt gctgggaaga        60
     agggatgacg gttatcatga ggtagagatg gttatgcaat ctatttctct gcatgatttg       120
     ctggagctgt ccctctcgga agagcaggaa aataataata tgggcaagat tattttgact       180
     gttgcaggtg ctgatttgcc tgttggtgag gagaatctgg tattcaggac ggcccgcata       240
     ttgcaggagt atacgggatg ccggttgggc tgctcaatac ttctgcataa aaagataccg       300
     gttgctgccg gtcttgccgg tgggtccgct gatgctgctg cggcactgct gggtcttaat       360
     aagttatgga atttggattt aactgttgca gaactgtatg ctttagcagc taaaattggt       420
     tctgatgtac ctttttgtat caaaggcggt acagtgctgg caaaaggaag aggcgagcag       480
     ttggcttttc tggaagccgc acccgatatg ggaattattt tagttaaacc tgcttatgga       540
     atatctaccg gggaggttta tagcaagctg aatagcgccg tttatcctca agttattaat       600
     acgatgcaaa aaaaagatat tactaatgat actaatgata tccataacat gttatgcctt       660
     tcggatttgg gaccgccggt actaagaatg attaaagcca taaaaagcag gcaattgcct       720
     gctgtatgta aggctttata taatattttg gaggaaccgg caatgaaaat gcacccgaac       780
     cttttagata taaaaaacat actatttgaa caaggagcga tgggtgtttt aatgtccggc       840
     agcggatcga caatttttgg catcactcct gatttagagg ccgcacatct gctgtctaag       900
     ggcctgagtc cttcgcttgg atctatttat gcggtgaaat tgcagggagc gagagaagta       960
     tga                                                                     963
//

If you have problems or comments...

PBIL Back to PBIL home page