(data stored in ACNUC7421 zone)

EMBL: CP001720.PE190

CP001720.PE190       Location/Qualifiers
FT   CDS_pept        220762..221463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0202"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: GntR domain protein; regulatory protein GntR
FT                   HTH; SMART: regulatory protein GntR HTH; KEGG:
FT                   gur:Gura_4161 GntR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61155"
FT                   /db_xref="GOA:C8W2Z9"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2Z9"
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /protein_id="ACV61155.1"
FT                   /translation="MDYPKLKEEPKLIPIKLDNYKPLREVVFESLREAIINGRLSPGER
FT                   LMEIQLAEEMGVSRTPVREAIRKLELEGFVVMIPRKGAYVAGISIKDIANVFEVRAALE
FT                   ALAAGLAAERITEEELDELERYLVEISELRESGNLDAIVEKDTMFHDVIYRASRNERLV
FT                   QIVTHLQEQIHRFRTASLARPGRTRDALDEHKKLVEAISDRDVELAQKLAREHIENAEN
FT                   SMISAVQEAGV"
     gtggattatc ctaaattaaa ggaagaacct aaattaattc caattaaact ggataattat        60
     aaaccattgc gggaagtggt ttttgaatct ttacgggaag ctattataaa tgggagatta       120
     tctccgggcg aacgtttgat ggagattcaa ctggccgagg agatgggtgt gagccggact       180
     cctgtgcgtg aggccattag aaaattagag ctggaaggtt tcgtggttat gattccccga       240
     aaaggtgctt atgtagctgg aatctccata aaggatatcg ctaatgtttt tgaagtaaga       300
     gcggctctgg aggcgttggc agccggtctg gctgcggaaa gaataacgga agaggaactg       360
     gatgagctgg aacgctacct tgtagaaata tcagagttgc gtgaaagcgg gaatttggat       420
     gctatagtcg agaaagacac tatgttccat gatgttattt acagggccag ccgcaatgaa       480
     aggttggtgc agatagtcac tcacctgcag gagcaaattc atcgttttcg taccgcttca       540
     ttagcaaggc ccggcaggac cagagatgca ctggatgagc acaagaagct tgtggaggct       600
     atatcggata gggatgtgga attggctcag aagctggcca gggagcatat tgaaaatgct       660
     gagaacagta tgatcagtgc tgtacaggag gccggtgtct aa                          702
//

If you have problems or comments...

PBIL Back to PBIL home page