(data stored in ACNUC7421 zone)

EMBL: CP001720.PE192

CP001720.PE192       Location/Qualifiers
FT   CDS_pept        222584..222841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0204"
FT                   /product="SpoVG family protein"
FT                   /note="PFAM: SpoVG family protein; KEGG: bha:BH0064
FT                   regulatory protein SpoVG"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61157"
FT                   /db_xref="GOA:C8W301"
FT                   /db_xref="InterPro:IPR007170"
FT                   /db_xref="InterPro:IPR036751"
FT                   /db_xref="UniProtKB/TrEMBL:C8W301"
FT                   /inference="protein motif:PFAM:PF04026"
FT                   /protein_id="ACV61157.1"
FT                   /translation="MMHVTDVRVRKILAEGKMKAIVSVTLNDAFVIHDVKVVEGQTGLF
FT                   VAMPSRKTPNGEFRDIAHPINSSAREIIQVAVLQAYEETV"
     atgatgcatg ttactgatgt tcgtgtgaga aagatacttg ctgagggtaa aatgaaagcc        60
     attgtatcag taaccctgaa tgatgctttc gtgattcatg atgtcaaagt ggtagagggc       120
     caaaccggtt tgtttgtggc tatgcccagc agaaagactc ctaacggtga gtttagggat       180
     attgcacatc cgataaattc gtcagcccgt gaaataattc aggtagctgt cttgcaagca       240
     tatgaagaga ctgtttaa                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page