(data stored in ACNUC7421 zone)

EMBL: CP001720.PE193

CP001720.PE193       Location/Qualifiers
FT   CDS_pept        223131..224507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0205"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /note="TIGRFAM: UDP-N-acetylglucosamine pyrophosphorylase;
FT                   PFAM: Nucleotidyl transferase; transferase hexapeptide
FT                   repeat containing protein; 4-diphosphocytidyl-
FT                   2C-methyl-D-erythritol synthase; KEGG: bha:BH0065
FT                   UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61158"
FT                   /db_xref="GOA:C8W302"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/TrEMBL:C8W302"
FT                   /inference="protein motif:TFAM:TIGR01173"
FT                   /protein_id="ACV61158.1"
FT                   /translation="MKLAAVVLAAGKGTRMKSKIPKVLHKVSGLPMISHVLHSVSKAGI
FT                   EKKVVVVGYQGDQVAAQLGQDVNIAVQEEQLGTAHALLSAESMLRDFSGHILVLCGDTP
FT                   LIKPQTLKDLVSFHVDSASVATVLTAKLEDPTGYGRVIRDKAGSVAKIVEQKDASPVEL
FT                   NIQEINTGIYCFQSEFLFEALRHISPNNAQGEYYLTDIIQLYVSQGRLVSAIAVVDAAE
FT                   IQGINDRVHLAAAESVLRRQMLDKLMLGGVTVIDPASTFIDQTVEIGTDTVILPYTCIE
FT                   GNTVIGSDCIIGPHTRLSDTRIGNCVEIQNSVLLKSDVGDQSSIGPFAYIRPDTVIGEQ
FT                   VKVGDFVEIKKSNIGNKSKIPHLSYIGDSEIAENVNIGAGTITCNYDGVAKHRTTIEEG
FT                   AFIGSNTNLVAPVSVGAGAVIGAGSTITMDVPPGALGVARGKQKNINNWLSRKTPEKRD
FT                   "
     atgaaactgg cggcggtggt cttggcggca ggcaagggca ccaggatgaa atcaaaaata        60
     ccgaaggtac tgcataaagt ttccggtctg cctatgatta gccatgtgct gcattcagtc       120
     agtaaagccg gcatagaaaa aaaggttgta gttgttggct atcagggtga ccaggtggct       180
     gctcaattag ggcaggatgt aaatattgct gtgcaggagg agcagttggg aaccgcccat       240
     gcattgcttt cggctgaatc gatgttaaga gacttctccg ggcatattct ggttttatgt       300
     ggtgatacgc ctcttataaa acctcaaaca ttaaaggatt tggtgtcctt tcatgtggat       360
     tcggcctcgg tagccacggt tttaacggcc aagcttgagg accctaccgg ctatggcagg       420
     gttattcggg ataaagctgg cagtgtagcc aaaatagttg agcagaaaga cgcctctccg       480
     gttgaattaa atatacaaga gataaataca ggtatttatt gcttccaatc cgagtttctt       540
     tttgaggctc taagacatat ttctcctaat aatgctcaag gagaatatta tttaactgat       600
     attattcagc tatatgttag tcaggggcgt ttggtaagcg ccatagctgt agttgatgct       660
     gctgaaatac aggggatcaa tgaccgtgtc catttagccg ctgccgagtc tgttttgcgc       720
     aggcagatgc ttgataaatt aatgctggga ggggtaacgg ttatagaccc tgcttccact       780
     tttattgatc agacggtaga gataggaaca gatactgtta ttctccctta tacttgtata       840
     gaagggaata ctgttattgg cagtgattgt ataattggtc cgcatacaag gttgtcggat       900
     acgcgaattg gcaattgcgt ggaaatacag aattctgttt tgctgaaaag tgatgttggt       960
     gatcagtctt ctataggacc tttcgcttat atcaggcctg atactgtaat aggtgaacag      1020
     gtgaaagtgg gggactttgt agaaataaaa aaatctaata taggtaataa gagtaagatt      1080
     cctcatttga gttatattgg tgacagtgaa attgctgaaa atgttaacat aggtgcgggc      1140
     actattactt gcaattatga tggagtggct aagcaccgta ctactataga agaaggtgcg      1200
     tttatcggca gcaataccaa cctggttgca cctgtcagtg tgggtgccgg tgctgttatc      1260
     ggtgccggtt cgactattac aatggatgtg cctcccggag cgttaggtgt agccaggggt      1320
     aaacaaaaaa atataaataa ctggttgtcc cgcaaaacac cggagaagag agattag         1377
//

If you have problems or comments...

PBIL Back to PBIL home page