(data stored in ACNUC7421 zone)

EMBL: CP001720.PE194

CP001720.PE194       Location/Qualifiers
FT   CDS_pept        224549..225496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0206"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /note="KEGG: bar:GBAA0049 ribose-phosphate
FT                   pyrophosphokinase; TIGRFAM: ribose-phosphate
FT                   pyrophosphokinase; PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61159"
FT                   /db_xref="GOA:C8W303"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/TrEMBL:C8W303"
FT                   /inference="protein motif:TFAM:TIGR01251"
FT                   /protein_id="ACV61159.1"
FT                   /translation="MSSRNKKLKIFTGNANPELAQEIVQYLGVNMGAAKVTRFSDGEIQ
FT                   VKINESVRGADVFIVQPTSAPVNENLMELLVMIDAVRRASARRITAVLPYYGYARQDRK
FT                   ARARDPITAKLVANLLFASGVRRVVTMDLHAGQIQGFFDIPVDHLPCVPILAEYFLQQH
FT                   IEDVVVVAPDVSGVTRARDLAERIGAPIAIIDKRRPEPNVSEVMHVIGDIQGKKVIMMD
FT                   DIIDTAGTITHGALALKKRGADEIYVCCTHAVLSGPAINRLQEAPIKEVLVTNTIPVTE
FT                   DKMLNKIKVLSVAPLLGEAIIRIHEDLSVSKLFD"
     atgtcatccc gcaataagaa actgaaaata tttaccggca atgcaaaccc ggaactggcg        60
     caggaaatag ttcaatatct tggagtgaat atgggagcgg ccaaggtaac acgattttcc       120
     gacggggaaa ttcaggttaa aatcaatgaa agtgtgcgcg gtgctgatgt ttttattgtt       180
     cagcctacca gtgctccggt taatgagaat ctgatggaac tattggtgat gattgatgcc       240
     gtgcggagag cctccgcccg gcgcattacc gctgttttgc cttattacgg ctatgccagg       300
     caggatcgta aagccagggc tcgtgatccg ataacagcca aactggttgc taatttgtta       360
     tttgccagtg gggttcgcag agttgttact atggacttgc acgccgggca gattcagggc       420
     ttttttgata ttccggttga tcacttaccc tgtgtgccaa tcctggctga atattttctc       480
     caacagcata ttgaagacgt agttgtagtg gcaccggatg ttagcggggt gaccagggcc       540
     agagatttgg ccgagcggat tggagcgcct attgccatta ttgataagcg ccgcccggaa       600
     cctaatgttt ctgaggttat gcatgtaatc ggggatatac aaggcaagaa agttattatg       660
     atggatgata taatagatac tgccggtacc attacccatg gggcccttgc cttgaagaaa       720
     aggggtgctg atgaaatata cgtctgctgt acccatgcag ttctttccgg gcctgcgatt       780
     aaccggctgc aagaggcacc gattaaagaa gtcctggtta ccaacactat accggtaacc       840
     gaggacaaaa tgttaaacaa aatcaaggtt ttatcggtgg cgccgcttct gggcgaagct       900
     attattcgta ttcatgaaga cctgtctgta agcaagttat tcgattga                    948
//

If you have problems or comments...

PBIL Back to PBIL home page