(data stored in ACNUC7421 zone)

EMBL: CP001720.PE20

CP001720.PE20        Location/Qualifiers
FT   CDS_pept        22461..23162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0021"
FT                   /product="LrgB family protein"
FT                   /note="PFAM: LrgB family protein; KEGG: tcx:Tcr_1938
FT                   LrgB-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACV60985"
FT                   /db_xref="GOA:C8VVB6"
FT                   /db_xref="InterPro:IPR007300"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVB6"
FT                   /inference="protein motif:PFAM:PF04172"
FT                   /protein_id="ACV60985.1"
FT                   /translation="MDKFFISPLFLVGLTLACYFVSLSFYKKYRLLLFHPVPLSSLIII
FT                   LFLYNRGINYITYEKATGFISFFLGPATLALGYNLYRDFSMIRRRVWPILLGSFCGAIA
FT                   GVFSVYILGKLLCINQSIIFSFLPKSTTTPIALAIATKYGGIGSLTVAAVVVTGILGAL
FT                   IGPEFLTLTGIRDNTARGLAMGSAAHAIGTSRALQENSEQGSLAGLAIILCGLFTALII
FT                   SMINIFKEYIF"
     atggataaat tttttatttc tccactgttt cttgtggggt taacactagc ctgctatttt        60
     gtctcacttt ctttttataa aaaatatagg ctgctcttat ttcacccggt acctttgtca       120
     tcattaataa ttattctttt cttgtataat agagggataa attatattac ctatgaaaaa       180
     gcaacagggt ttatttcatt ttttttggga cctgctacac tggctttagg ttataattta       240
     taccgggatt tttccatgat tcggcgtaga gtatggccca ttttattggg ttccttttgc       300
     ggagccattg cgggtgtttt ttccgtatat attctgggca agctgctctg tattaatcaa       360
     tcaattatct tttctttttt gcctaaatca accactacac caatagctct ggctattgcc       420
     actaaatacg ggggtatcgg ctcgttaacg gttgctgctg ttgttgtaac cggtattttg       480
     ggagccctga ttggcccgga atttcttact ctaaccggta ttagggataa tactgccaga       540
     gggctggcta tgggcagcgc tgcccatgcc ataggaacca gccgggctct ccaggaaaac       600
     agcgaacagg gctccctggc tggtttggca attattcttt gcggactttt tacagctttg       660
     attatcagta tgattaatat atttaaagag tacatatttt aa                          702
//

If you have problems or comments...

PBIL Back to PBIL home page