(data stored in ACNUC7421 zone)

EMBL: CP001720.PE200

CP001720.PE200       Location/Qualifiers
FT   CDS_pept        230110..230505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0212"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61165"
FT                   /db_xref="GOA:C8W309"
FT                   /db_xref="UniProtKB/TrEMBL:C8W309"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61165.1"
FT                   /translation="MLFLLSGLASACIAWCINYLLFQLLINKSKAVLAAPVVEELSKTL
FT                   IAINLGASILYTHLVFGLVEAVWDIRNSHKLGLTAAWMSVGGHAVFGLSAQIIYMNQQK
FT                   ILYSVAAGLIIHLIWNRMIYRLVINNN"
     ttgttgtttc ttctttcagg actggcgtca gcgtgtattg cctggtgtat taattatctg        60
     ttatttcagt tgctaataaa taagtcaaaa gctgttttgg ctgccccggt tgtggaggaa       120
     ttatccaaaa cactgattgc tataaacctg ggcgcgtcga ttctttacac tcatttagtt       180
     ttcggtctgg tagaagcggt ttgggatatt agaaattcgc acaagctggg gcttaccgcg       240
     gcctggatga gtgtgggtgg acatgcggtg tttggtttgt cggcgcaaat tatttatatg       300
     aaccagcaga aaattttata ttctgttgcc gcaggattaa ttatacatct tatttggaat       360
     cgtatgattt atcgcttggt tataaacaac aattaa                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page