(data stored in ACNUC7421 zone)

EMBL: CP001720.PE205

CP001720.PE205       Location/Qualifiers
FT   CDS_pept        236301..236417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0217"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61170"
FT                   /db_xref="UniProtKB/TrEMBL:C8W314"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61170.1"
FT                   /translation="MAVRPLLIAMLENHACTSQRHDEAGAYITEKYFIGSEA"
     gtggccgtaa ggccacttct tattgctatg ttagaaaacc atgcttgtac aagtcaaagg        60
     catgatgaag ccggtgcgta tataacggaa aaatatttta taggatccga ggcataa          117
//

If you have problems or comments...

PBIL Back to PBIL home page