(data stored in ACNUC7421 zone)

EMBL: CP001720.PE208

CP001720.PE208       Location/Qualifiers
FT   CDS_pept        238499..238759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0220"
FT                   /product="RNA-binding S4 domain protein"
FT                   /note="PFAM: RNA-binding S4 domain protein; SMART:
FT                   RNA-binding S4 domain protein; KEGG: bha:BH0073
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61173"
FT                   /db_xref="GOA:C8W317"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025490"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:C8W317"
FT                   /inference="protein motif:PFAM:PF01479"
FT                   /protein_id="ACV61173.1"
FT                   /translation="MRLDKFLKVSRVIKRRTLAKEVCDRGQATLNSRVAKAGSEVKAGD
FT                   ILEINFGTRKIKLEILLVLSNVPAKEASTMYSILEDIRLDF"
     atgcgcttag ataagtttct taaagtatct cgcgtaatta agagaagaac cctggccaaa        60
     gaggtttgtg atagaggaca ggcaacttta aactcgcgcg ttgctaaagc aggcagcgaa       120
     gtaaaggccg gcgatatttt agagataaat ttcgggacca gaaaaataaa attggaaatt       180
     cttttggttt tgtccaatgt ccctgcaaaa gaggcttcta ccatgtattc tatattagaa       240
     gatatccggc tggatttcta g                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page