(data stored in ACNUC7421 zone)

EMBL: CP001720.PE209

CP001720.PE209       Location/Qualifiers
FT   CDS_pept        238818..239768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0221"
FT                   /product="SpoIID/LytB domain protein"
FT                   /note="TIGRFAM: SpoIID/LytB domain protein; PFAM: Stage II
FT                   sporulation D domain protein; KEGG: gur:Gura_1714
FT                   SpoIID/LytB domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61174"
FT                   /db_xref="GOA:C8W318"
FT                   /db_xref="InterPro:IPR013486"
FT                   /db_xref="InterPro:IPR013693"
FT                   /db_xref="UniProtKB/TrEMBL:C8W318"
FT                   /inference="protein motif:TFAM:TIGR02669"
FT                   /protein_id="ACV61174.1"
FT                   /translation="MSRRQMHFLLVTVLILNSLFFYGCSSSSVRKPSPERLKKEPTISL
FT                   YVKETGQKKQLKMEEYVAGVVAAEMETNWPINALAAQAIIARTYTMKNMETGKIKKLHG
FT                   TDASTDIEEFQAYDAAKINSNVRKAVRMTRGQVITYKGKYPNAWFSACCGGITASAQEG
FT                   LAFTQEATPYIKAGVRDNCLSITVPENRHWQASVPKEKVLAAVRQLTGANPGSLAPVKI
FT                   TEKGDSGRAVKIKLGDTELGGPALRNAVGSDVVRSILLNRLFMQGNNVVFTGKGFGHGV
FT                   GLCQWGANLMAQKGKGPEDIINFYYQGVQIEKKWE"
     atgagtagaa gacaaatgca ttttttgctg gtaactgttt taattctgaa cagccttttc        60
     ttttatggct gcagcagcag ctctgtcaga aaaccttcac ctgaaagatt aaagaaagaa       120
     cctactatta gcttgtacgt taaagagact ggtcaaaaga agcagttgaa gatggaggaa       180
     tatgtagccg gcgtagtagc ggcggagatg gagacgaact ggcctatcaa cgctctggct       240
     gcccaggcaa taatagcccg tacctatact atgaaaaata tggagacagg aaaaattaag       300
     aagctgcatg gcaccgatgc ctctacggat atagaggagt ttcaagctta tgatgcagct       360
     aagataaata gtaatgtccg caaagctgta cgtatgacca gagggcaggt aataacttat       420
     aaggggaaat atcctaacgc ctggtttagt gcctgttgtg gcggcattac agcttccgcg       480
     caggaagggt tggcctttac tcaggaagcc accccatata ttaaggctgg agtgagggat       540
     aattgtttat ccataacagt gcctgagaac aggcactggc aggcaagtgt gcctaaagaa       600
     aaggtgttgg ccgcggtgcg gcaattgaca ggtgcaaacc cgggttcatt ggcaccggtt       660
     aaaataacgg aaaaaggcga ttcaggccgt gctgtaaaaa taaagctggg cgataccgaa       720
     ttgggcggac cggccttgcg caatgctgtt ggcagtgatg ttgtaaggtc catactttta       780
     aaccgcttat ttatgcaggg taataatgtg gtttttaccg ggaaaggctt tggccacggg       840
     gttggtttgt gtcagtgggg ggccaatcta atggcccaga aaggcaaagg accggaggat       900
     attattaatt tttattatca gggagtgcaa attgaaaaaa aatgggaata a                951
//

If you have problems or comments...

PBIL Back to PBIL home page