(data stored in ACNUC7421 zone)

EMBL: CP001720.PE212

CP001720.PE212       Location/Qualifiers
FT   CDS_pept        240938..241306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0224"
FT                   /product="Septum formation initiator"
FT                   /note="PFAM: Septum formation initiator; KEGG: bha:BH0076
FT                   cell-division initiation protein (septum formation)"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61177"
FT                   /db_xref="GOA:C8W3S3"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3S3"
FT                   /inference="protein motif:PFAM:PF04977"
FT                   /protein_id="ACV61177.1"
FT                   /translation="MISSSQQERNMYIPPKGDQQKKVSFRLTKNKIPLIVGIIMALYLG
FT                   LSLVNQFNKLQLIHNDLEVMQKEVDSLKTKNQSLREELKNVQSNAYIEQVAREKLGLVK
FT                   PGEKRIVPVDKNQPQIPD"
     atgatatcat catcgcagca ggaaagaaat atgtatattc cacccaaggg tgaccagcag        60
     aaaaaagtca gctttcgttt aacaaagaat aaaatacctc ttatcgttgg gattataatg       120
     gctctttatt taggtttgtc tttagttaac cagtttaata agctgcaatt aatacataat       180
     gacctagagg tgatgcaaaa agaagtagat agtttaaaaa caaaaaatca atctctcagg       240
     gaagagttga agaatgtgca gtccaatgcc tatattgaac aagtggcacg tgaaaagttg       300
     ggtttggtta agcccggaga aaaaaggatt gtacccgttg ataagaacca gcctcaaata       360
     ccggattag                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page