(data stored in ACNUC7421 zone)

EMBL: CP001720.PE213

CP001720.PE213       Location/Qualifiers
FT   CDS_pept        241467..241871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0225"
FT                   /product="RNA binding S1 domain protein"
FT                   /note="PFAM: RNA binding S1 domain protein; SMART: RNA
FT                   binding S1 domain protein; KEGG: bsu:BSU00630 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61178"
FT                   /db_xref="GOA:C8W3S4"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3S4"
FT                   /inference="protein motif:PFAM:PF00575"
FT                   /protein_id="ACV61178.1"
FT                   /translation="MSIVVGSILEGVVTGITSFGAFVGLADGQTGLVHISEVAEAYVKD
FT                   VNEFLRIGDKVKVKVVAVDVKGKIGLSIKRAKVTASYDRRKKSVSFEDRLSKFLKDSDE
FT                   RQQDLKKIIDSKRGGRGAAKRASVVVTNKK"
     atgtcaatcg tagtagggag catattggaa ggtgtggtta ccggaattac cagtttcgga        60
     gcctttgtag gattggctga tggacaaaca ggtctggtac atatttctga ggttgctgag       120
     gcgtatgtta aagatgtaaa cgagttttta agaatcggtg ataaggttaa ggttaaagtt       180
     gttgccgttg atgttaaagg caagataggt ttatcaatca agcgtgctaa ggttactgct       240
     tcttatgaca ggcgtaagaa atctgtttct ttcgaggaca ggttgtcgaa attccttaaa       300
     gacagtgatg agagacagca ggatttaaag aaaataattg actcgaaacg cggcggcagg       360
     ggtgctgcaa agcgtgcttc tgtggtggta accaataaga aatga                       405
//

If you have problems or comments...

PBIL Back to PBIL home page