(data stored in ACNUC7421 zone)

EMBL: CP001720.PE215

CP001720.PE215       Location/Qualifiers
FT   CDS_pept        242863..245418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0227"
FT                   /product="stage II sporulation protein E, protein
FT                   serine/threonine phosphatase"
FT                   /EC_number="3.1.3.16"
FT                   /note="KEGG: bar:GBAA0061 stage II sporulation protein E;
FT                   TIGRFAM: stage II sporulation protein E; PFAM: Stage II
FT                   sporulation E family protein; SMART: protein phosphatase 2C
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61180"
FT                   /db_xref="GOA:C8W3S6"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR014221"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3S6"
FT                   /inference="protein motif:TFAM:TIGR02865"
FT                   /protein_id="ACV61180.1"
FT                   /translation="MTKYSHTIVYNKTVGKLYTRGGLILFEKTDAYPYSREYGTKKTAT
FT                   PKTKEMFSDYQWFRLNQLFNWNSLMVFILGFFMGRVVLLGELMPFGPAFVSAGLSLGFG
FT                   PAVVLGAVAGLFSVLQGMELVARFVIIVCLVGVYYSVPKNLRAHPVVLPGVVGAVALVV
FT                   RTVYLSMSDPVPYNYVSSAFEAFIAALLSFVYLRSLPLLTLVCGERTKKLSAERVFYLL
FT                   LLLGGLIAGSAGIGYANITLQGLLSRLVVLIAAYAGGTGMGAAVGALVGVLPGLVFTAM
FT                   PALVGAYSFAGLLAGFSRRFGKAGSILGFVLGNIILCVYMSGYDRLTGVLGETGLASLI
FT                   FFLLPDRIMRCWSSLRTENHMPLVDSGDKDCPQNNRFKEILAYRIQGMATVFQELFKSY
FT                   EQSALADLSTHEDRSPQDLVDEIVRRVCGDCPLHRICWEKDFYRTYQYLLDMLARAEAS
FT                   DSRDLDNIPQFLRSRCTRIKELWLTVLCLNELYSAKKLWFGRMKKSREIISEQLKTVCH
FT                   ITDKLVEELQASAGLFEHHDFDLLASLKEKGLDIFDVYTTRQPGGHLEVVINMPSCRGM
FT                   INCRYKVAPVLTELLGQPYSVVGMNCFSHQKGTERNIMGQESAGYCNFRLYPSLLYRLE
FT                   VGMARSGKGGSDICGDSYSVVYLNQGKVALILSDGMGSGVSAELESSMTIRLLERLLKS
FT                   GLEREPAIRMVNSVMLMRSAEDSFATIDLVIIDLCNGSSEFVKIGAPPGYLVRGKRVAP
FT                   ITSSALPIGIIDDIEITTVAKTLVDGDMLVMVTDGVTDACRTSDHEEDWLLKVLPETRN
FT                   LPPQEVAEFIMQLAQTCSEKDNKYDDMIVMAVRIEKEGI"
     atgacaaaat attcccatac tattgtatat aataaaactg ttggtaaatt atatacaagg        60
     ggtggcctta ttttgttcga aaaaacagat gcgtaccctt attcgagaga atatggcact       120
     aagaaaacgg caactcctaa aacaaaggag atgttctccg attatcaatg gttccggtta       180
     aatcagttat tcaattggaa cagtctcatg gtatttatac taggtttctt tatgggacgg       240
     gttgttttac tcggtgaatt aatgcctttt ggacctgctt tcgtttctgc cggtctttct       300
     ctggggtttg gtcccgcagt agttttgggt gcggttgcag gccttttttc cgtattgcaa       360
     ggtatggaac tggtggcccg tttcgtaatt attgtttgtt tggttggggt atattattct       420
     gttcccaaaa atctacgggc tcatccggtt gttttgccag gtgtggtagg ggctgtagct       480
     ctggttgtaa gaacggtata tctttctatg agtgatccgg taccttacaa ttatgtcagt       540
     tcggcttttg aagcctttat agctgctctt ttgtcctttg tgtacttgag gtcactcccg       600
     ctgttgactt tagtttgcgg ggaaagaacc aaaaagcttt ctgcggaaag agttttttat       660
     ttgctactgc tgctcggcgg cctaattgcg gggtcggcag ggattggtta tgctaatatt       720
     actttgcagg gtcttttaag caggttggtc gtattgattg ccgcctatgc cggcggtacg       780
     ggaatgggtg ccgcagtagg agcgctggtt ggcgtattgc ccggtttggt ttttacagct       840
     atgcccgctc tggtaggggc ctattctttt gccggattac tggccggttt cagcagacgt       900
     tttggtaaag ccggatcgat tttgggtttt gtcctgggca atattatctt atgtgtctat       960
     atgtccggat atgatagatt aacaggggtc ctgggggaaa ccggactggc atcacttatc      1020
     ttttttctgt tgcctgacag gataatgagg tgttggtcca gcttgcggac tgaaaatcat      1080
     atgccgttgg tagattcagg agataaggat tgtccgcaga ataaccgctt taaggagatt      1140
     ctggcctatc gcatacaagg catggccaca gtctttcaag aattatttaa gagctacgaa      1200
     cagtctgctt tagcagattt atcaactcat gaagacagga gtccccagga tttggttgat      1260
     gagattgttc gcagagtttg cggtgattgt ccactgcacc gtatttgttg ggaaaaagac      1320
     ttttatcgta cttaccagta tttgttggat atgctggcca gggctgaagc ctccgatagc      1380
     agggacttgg ataatattcc gcaatttttg cgcagtcgct gtaccagaat taaagaactg      1440
     tggttgacag tgctttgctt aaacgagctt tatagtgcga aaaaattatg gtttggtcgt      1500
     atgaagaaga gccgggaaat tattagcgaa cagctcaaaa ccgtatgtca tattacggat      1560
     aagctggtag aagaattgca agcgagcgcc ggattgttcg aacatcatga ttttgatttg      1620
     ttagcatcgc taaaggaaaa aggcttggat atatttgatg tttatacaac ccgacagccc      1680
     ggtgggcatt tagaagttgt tattaacatg ccttcttgcc gtggaatgat aaactgtcgt      1740
     tataaagtag caccggtttt gacggagttg ttgggacaac cttattcagt tgtaggaatg      1800
     aattgttttt cccatcaaaa gggaaccgag cgaaatatca tgggtcagga atctgccggc      1860
     tactgcaatt ttaggctgta tccttcttta ttataccgtc ttgaggtagg tatggccaga      1920
     tcaggtaaag gtggcagtga tatttgtgga gacagttatt cggttgtata tttaaaccag      1980
     ggtaaggtag cgttgatttt gagtgatggc atgggcagcg gggtttcggc tgaattagag      2040
     agcagcatga caatcaggct tttggagaga ctgctgaagt ctggattgga acgagaacct      2100
     gctatcagaa tggttaattc agtaatgcta atgcgttcag cagaagacag tttcgctact      2160
     attgatttgg tgattattga tttatgtaac gggagcagtg agtttgttaa aataggcgcg      2220
     cctccaggtt atctggttcg tgggaaaagg gtggcaccaa taacctcgtc agccttgcct      2280
     attgggatta ttgatgatat agaaataact actgttgcta aaactctggt tgacggggac      2340
     atgctggtta tggttactga cggtgtaaca gacgcttgtc gtacctctga ccatgaggag      2400
     gactggttgc ttaaggttct gcctgagaca agaaatttgc cgccacagga agtagcggaa      2460
     tttattatgc aattggcaca gacttgctct gagaaagaca ataaatacga tgacatgatt      2520
     gttatggcag taagaattga aaaagaaggt atataa                                2556
//

If you have problems or comments...

PBIL Back to PBIL home page