(data stored in ACNUC7421 zone)

EMBL: CP001720.PE216

CP001720.PE216       Location/Qualifiers
FT   CDS_pept        245882..247303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0228"
FT                   /product="tRNA(Ile)-lysidine synthetase"
FT                   /note="TIGRFAM: tRNA(Ile)-lysidine synthetase; PFAM:
FT                   PP-loop domain protein; KEGG: sat:SYN_02776
FT                   tRNA(Ile)-lysidine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61181"
FT                   /db_xref="GOA:C8W3S7"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3S7"
FT                   /inference="protein motif:TFAM:TIGR02432"
FT                   /protein_id="ACV61181.1"
FT                   /translation="MTGTLKQVLKYINKHRMVNKGDKILLAVSGGPDSVAMLDVLFCLR
FT                   HDLGISLHIAHLNHMFRGEESLGDAEFVRELAVRYNLPVTVRHINVPSFMEKTGLSSQP
FT                   AARTVRYSFLDETAAQESASRIALAHHADDQAETVMLHFLRGSGAAGLRGMLPVRDNFY
FT                   IRPMLCLKRQDIEDYCKKKNLRWRVDSSNLKTDYRRNKIRMYLLPLLEKEYNNNLTATL
FT                   NRLADIFREEEDYLELMTRNEYNNLTVLKSAGEICLNLKGFQQVPLALQRRILRLAWRE
FT                   ITGGFRDLAFEQLGKAVILLTNHVGSGSLEFPRDVKVVKRYDSFSFIIGKDKQDGLSYY
FT                   YDLPVPGKVYLAEINRTLFCEVADTQAMDEKYDKSFLNRRRFSQDEAWLDYERVAFPLC
FT                   VRGRQPGDIFEPLGLTGSMKLKKYFINQKVPCEVRDKVPLVIGEGKIIWVGGMQISESV
FT                   KINEVTTKFLHLFLV"
     ttgaccggta cattgaaaca agttcttaag tatataaata aacatcggat ggttaacaaa        60
     ggagataaaa ttctgcttgc tgtttcaggt ggcccggatt cggtagccat gttggatgtg       120
     ttgttttgtc tcagacatga cttgggtatc tcattgcaca tagctcattt gaatcatatg       180
     tttcgtggcg aggagtcttt gggtgatgct gagtttgtca gggaactggc tgtgcgttat       240
     aatttgccgg ttactgtgcg acatataaac gtcccgtcct ttatggagaa aaccggcctt       300
     tcttcacaac cggcagcgcg aacggtgcgg tatagttttt tagatgaaac tgccgctcag       360
     gaatccgcat ccagaattgc acttgctcac catgctgatg atcaggcaga aacagtgatg       420
     ctgcattttt tgaggggtag cggagctgcc gggttaaggg gaatgcttcc ggtgcgcgat       480
     aatttttata tcaggccgat gctttgtctt aaaaggcagg atattgagga ttattgcaaa       540
     aagaaaaacc tgcgctggcg cgtggacagc tcaaatctta aaactgatta tcgacgtaat       600
     aaaattagga tgtatttact gccgctatta gaaaaagaat ataacaataa ccttacagcc       660
     acactaaatc gcttggcaga tatctttcgg gaagaagaag attatttgga attaatgacg       720
     cgtaatgagt ataataattt aactgtacta aaaagtgcag gggagatttg tttgaatcta       780
     aaggggtttc agcaagttcc tttagccttg caaaggcgta ttctgcgcct ggcctggcga       840
     gaaatcaccg gtggctttcg ggacttggct tttgagcaac ttggtaaggc ggttattctt       900
     ttgacaaatc atgtaggcag cggcagcctg gaatttccta gagatgttaa ggtggtaaaa       960
     agatatgaca gcttttcatt tataattggc aaggataagc aggatggatt atcctattat      1020
     tatgacttgc cggtgcccgg taaagtatac cttgcggaaa taaacagaac gctgttctgc      1080
     gaggttgcag acactcaggc aatggatgaa aagtatgata agagtttttt aaatcgccgc      1140
     cgattctcac aagacgaagc ctggttagac tatgaacgag tagcttttcc tctctgcgta      1200
     cggggcagac agcccggaga tatttttgaa ccgcttggtt tgaccggttc gatgaaacta      1260
     aagaaatatt ttattaacca aaaggttccc tgtgaggtaa gggataaggt tcccctggtc      1320
     attggagagg gcaaaataat ttgggtcgga gggatgcaaa tttcagaaag tgtcaaaatt      1380
     aatgaagtaa ccacaaaatt tcttcatctg tttttggttt aa                         1422
//

If you have problems or comments...

PBIL Back to PBIL home page