(data stored in ACNUC7421 zone)

EMBL: CP001720.PE217

CP001720.PE217       Location/Qualifiers
FT   CDS_pept        247409..249235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0229"
FT                   /product="ATP-dependent metalloprotease FtsH"
FT                   /EC_number="3.6.4.3"
FT                   /note="KEGG: baa:BA_0654 peptidase_M41, peptidase family
FT                   M41; TIGRFAM: ATP-dependent metalloprotease FtsH; PFAM:
FT                   peptidase M41; peptidase M41 FtsH extracellular; AAA ATPase
FT                   central domain protein; ATPase associated with various
FT                   cellular activities AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61182"
FT                   /db_xref="GOA:C8W3S8"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3S8"
FT                   /inference="protein motif:TFAM:TIGR01241"
FT                   /protein_id="ACV61182.1"
FT                   /translation="MLNKVIKNLSIYLLIVLVIIVLIKYASPQETPVLPIRYDEFYQQL
FT                   QQGRISKVVIQTEPTIDFVNGEYKDGTKFSTKVDRPDATLKQILLEKKVKVEYKEPPEP
FT                   GWWTGLLTTMLPILVFVLLFFFMMQQTQGGGNRVMSFGKSRARMHTDEKKKVTFKDVAG
FT                   ADEVKEELEEVVDFLKSPKKFTELGARIPKGVLLFGPPGTGKTLLARAVAGEAGVPFFS
FT                   ISGSDFVEMFVGVGASRVRDLFEQAKKNAPCIVFIDEIDAVGRQRGAGLGGGHDEREQT
FT                   LNQLLVEMDGFNPNEGIIIIAATNRPDILDPALLRAGRFDREIIVDRPDIIGRKEILKV
FT                   HASGKPLEASVDLEVLARRTPGFTGADLANLINEAALLSARYNKKTIGMNELESAIERV
FT                   MAGPEKKSKVISDNEKKLVSYHEAGHALVGYLLPTTDPVHKVSIIPRGRAGGYTLLLPK
FT                   EDRYYMTKSQLLDQVTMLLGGRVAEDLVLKEISTGAQNDLERSTGLVRKMIMEYGMSDA
FT                   LGPLTLGHKQEQVFLGRDIARDINYGKDVANAIDKEVRRVVDSCYSNAKDMLSKHIKTL
FT                   HLIAETLMEKETIGADDFIKLMEDAGEEEQKL"
     ttgttgaaca aggtcataaa gaaccttagt atttacttgc tgattgtact ggtaatcata        60
     gtcttgatta aatatgcttc gcctcaagaa acaccggtac tcccgataag atatgatgag       120
     ttttaccagc aactccagca gggacggatt agtaaggtgg taatacaaac tgagcccaca       180
     atagatttcg ttaatggcga atacaaggat ggaaccaagt tttctaccaa ggttgaccgc       240
     cctgacgcca cgctaaagca aattctattg gagaaaaaag taaaagtgga gtataaggaa       300
     ccacctgaac caggttggtg gacggggctt ttaacaacta tgctgcctat tttggttttt       360
     gtcctgctct ttttctttat gatgcagcaa acgcaggggg gcggcaacag agttatgtct       420
     tttggcaaaa gccgggccag aatgcatact gacgagaaga aaaaagtgac ttttaaagat       480
     gttgccgggg ctgatgaggt taaggaagaa ctggaagaag tagttgactt tttaaaaagc       540
     cccaaaaagt ttaccgaatt gggggccagg attcccaagg gagtcttgct gtttggccct       600
     ccgggtacag gtaagacatt attggccagg gctgttgccg gagaagccgg tgtacccttt       660
     ttcagtatca gcggttccga ttttgtagaa atgtttgtcg gtgtgggtgc ctcccgcgtg       720
     cgggatttat ttgagcaggc taagaaaaac gcgccttgca tagtttttat tgatgagata       780
     gatgctgtcg gaagacagag aggtgccggt ttgggtggag gtcatgatga gcgggagcag       840
     accttaaacc agttattggt tgaaatggat ggatttaatc ctaatgaggg gattattata       900
     atagctgcaa ccaaccgtcc tgatattctg gaccctgctt tgcttagagc cgggcgtttt       960
     gaccgggaga ttattgttga taggcctgat attattggca gaaaagaaat tttgaaagtc      1020
     catgcgagcg gcaaaccttt ggaagctagt gtggatttgg aagtgctggc acgacgtacc      1080
     cctggtttta ccggtgcgga tttagccaat ttgatcaatg aagcggcgtt gttgtcagcc      1140
     cgttataaca aaaaaactat cgggatgaat gaacttgaaa gcgcgattga gagagttatg      1200
     gccgggccgg agaaaaaatc taaagttatc agtgataatg agaaaaagct ggtttcttac      1260
     catgaggcag gccacgctct ggtagggtat ttattgccta ctactgatcc tgtgcacaag      1320
     gtttccatta ttccacgcgg ccgggcaggg gggtatacgc ttcttttgcc taaagaagac      1380
     cgctactaca tgacaaaatc tcagctgctg gatcaagtga ccatgttgtt gggaggcaga      1440
     gtcgcagaag atttagtgct taaagaaatt agcaccgggg cccaaaatga tttggaacgc      1500
     tccacagggt tagtcaggaa aatgattatg gaatacggga tgagtgatgc tttaggtccc      1560
     ctcactttag gacacaagca agagcaagtc tttttgggcc gcgatattgc ccgcgatata      1620
     aattatggaa aagacgttgc taatgctata gataaagaag taaggagagt tgtggacagt      1680
     tgctatagca atgccaagga tatgttgagt aagcatataa aaaccctgca cttaattgcg      1740
     gaaacattga tggaaaaaga gactatagga gcggatgact ttattaagtt aatggaagat      1800
     gccggggaag aagagcaaaa gctgtga                                          1827
//

If you have problems or comments...

PBIL Back to PBIL home page