(data stored in ACNUC7421 zone)

EMBL: CP001720.PE219

CP001720.PE219       Location/Qualifiers
FT   CDS_pept        250102..251805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0231"
FT                   /product="Formate--tetrahydrofolate ligase"
FT                   /EC_number="6.3.4.3"
FT                   /note="PFAM: formate-tetrahydrofolate ligase FTHFS; KEGG:
FT                   fthS; formate-dihydrofolate ligase ; K01938
FT                   formate--tetrahydrofolate ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61184"
FT                   /db_xref="GOA:C8W3T0"
FT                   /db_xref="InterPro:IPR000559"
FT                   /db_xref="InterPro:IPR020628"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3T0"
FT                   /inference="protein motif:PRIAM:6.3.4.3"
FT                   /protein_id="ACV61184.1"
FT                   /translation="MKVVPSDLEIVQAHKMTPIGEIAAKMGLTEDDFDYYGKYKAKISL
FT                   DVIEKFKDRPNAKLIDVTAITPTPLGEGKTVTTISLTQGLGHIGKKVICTLRQPSLGPV
FT                   FGIKGGAAGGGYAQVVPMEDLNIHFTGDIHAIETANNLLAAMIDTSILLDNPLNIDPMS
FT                   IMWRRVFDLNDRALRDIVIGLGGKENGYPRQTGFDIAVASEVMAILALTTSLQDMRERF
FT                   ARIIFGFTYDGKPVTAEQIKAAGSMTVIMKEAIKPNLVQTLEGQPCIMHAGPFANIAHG
FT                   QNSVLADMIALKCADYVVTESGFGADMGMQKFMDIKCRQSGLRPNCVVVTSTVRSLKMH
FT                   GGVGNIVAGKPLPKELTEENLPALEKGAANMMHMIKIAKGYGIPVVVSINRFITDTDNE
FT                   INLLKDKAKEAGAFGVGVNTAWGDGGVGCAEVAELVVKACEEPTDFQFLYPDSFTIKEK
FT                   IETMAKKIYNADGVSYDPLAEKKIAQFEELGLGNLPINMAKTHLSISHDPGMKNVPSGY
FT                   IFPIRDIRASVGAGFLYPLAGAMRTMPGLGRAPSAIKVDIDKDGKIVGLF"
     atgaaagttg tacctagcga tcttgaaatt gtacaagcgc acaagatgac cccgattggg        60
     gaaattgctg caaaaatggg tcttaccgag gacgattttg attattatgg caagtataaa       120
     gccaaaatta gtctggacgt aattgaaaag tttaaggatc gtcctaacgc aaaactaatc       180
     gatgttactg ctattactcc cactccgctg ggcgaaggta aaaccgttac caccatcagc       240
     ttgactcaag gtttaggaca tattggcaaa aaggttatct gcacactgcg tcaaccttct       300
     ctgggccctg tttttggtat taagggcggt gccgctggcg gcggttatgc tcaggtagtt       360
     cctatggaag atctgaacat ccatttcacc ggtgacattc atgctattga aactgctaac       420
     aacctgctgg cagctatgat tgatacttca atcctgcttg acaaccccct gaacatcgat       480
     ccgatgtcta tcatgtggag acgcgttttt gacttaaacg accgtgcgct gcgtgacatc       540
     gttattggtt taggcggtaa agaaaacggt tatccgcgtc agaccggctt tgacattgct       600
     gttgcttccg aagttatggc tattctcgca ttaaccacca gcttgcagga tatgcgtgag       660
     cgttttgctc gcatcatctt tggttttacc tatgacggaa agcctgttac tgctgagcaa       720
     atcaaggctg caggctctat gacagttatt atgaaggaag ctatcaagcc gaacctcgta       780
     cagaccttag aaggccagcc ttgcattatg cacgcaggcc cgtttgctaa cattgctcat       840
     ggtcaaaact ccgttctggc tgacatgatt gccctcaagt gtgcagacta tgttgtaacc       900
     gagtccggtt tcggtgctga catgggtatg cagaagttca tggatatcaa atgtcgtcaa       960
     tccggcttgc gcccgaactg cgtagtagta acctctactg ttcgttcact gaaaatgcat      1020
     ggtggcgtag gtaatatcgt tgcaggtaaa ccgctgccga aagaattgac agaagagaac      1080
     ctgccggctc tggaaaaagg cgcggccaac atgatgcata tgattaagat agctaagggt      1140
     tatggaatac cggttgttgt atccattaac cgtttcatca ctgacaccga caatgaaatt      1200
     aacttgctta aagataaggc taaagaagca ggcgcctttg gcgttggcgt caacactgcc      1260
     tggggtgacg gcggcgttgg atgtgctgaa gtggctgaat tggttgttaa ggcttgcgaa      1320
     gaaccgactg acttccagtt cctctatccc gacagcttta ccattaagga aaaaatcgaa      1380
     accatggcta agaaaatcta caacgctgac ggcgtatcct atgacccgct ggcagaaaag      1440
     aaaattgctc agtttgaaga actcggctta ggcaatttac cgatcaacat ggctaagact      1500
     cacctgtcca tctcacatga tccgggaatg aagaatgttc cgagcggcta cattttcccg      1560
     atccgtgata ttcgcgcatc cgtaggtgcg ggcttcctgt atcctctggc aggcgcaatg      1620
     agaactatgc ctggtttggg acgtgcgcct tccgctatta aggttgatat tgataaagac      1680
     ggcaagatag ttggtttgtt ctag                                             1704
//

If you have problems or comments...

PBIL Back to PBIL home page