(data stored in ACNUC7421 zone)

EMBL: CP001720.PE221

CP001720.PE221       Location/Qualifiers
FT   CDS_pept        254196..254660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0233"
FT                   /product="protein of unknown function DUF134"
FT                   /note="PFAM: protein of unknown function DUF134; KEGG:
FT                   dat:HRM2_31170 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61186"
FT                   /db_xref="InterPro:IPR002852"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3T2"
FT                   /inference="protein motif:PFAM:PF02001"
FT                   /protein_id="ACV61186.1"
FT                   /translation="MSRPPKCRRVEHVPHLTYFKPAGVPLCDLEEVCLTVEELESVRLK
FT                   DYEGLEQEACAEKMGISRPTFHRIVIAARAKIADALVYGKAIRVNGGNFELAMEKIVCS
FT                   NCNHEWEAPYRHTHKRGKCKGGSEVKQRRDVECPRCREKLADMHSAEKND"
     atgtcaagac caccaaaatg ccggagggtt gagcatgtgc ctcatttgac ctattttaag        60
     ccggcaggtg tgcctttgtg tgatttggag gaggtttgcc tgactgtaga agaattagag       120
     tcagtgcgac tcaaggacta tgagggttta gaacaggaag cttgtgctga gaaaatggga       180
     atctcccgtc caacctttca ccgtattgtg attgccgcac gggctaaaat agctgatgct       240
     ttagtttatg gaaaggccat ccgtgtgaat ggaggcaact ttgaattggc tatggaaaaa       300
     attgtatgtt caaattgtaa tcacgagtgg gaagctccct accggcatac gcataaacga       360
     ggtaaatgta agggaggctc ggaggttaaa caaagaagag acgttgaatg tcctcgctgc       420
     agggaaaaat tagctgatat gcattctgca gagaaaaatg attga                       465
//

If you have problems or comments...

PBIL Back to PBIL home page