(data stored in ACNUC7421 zone)

EMBL: CP001720.PE223

CP001720.PE223       Location/Qualifiers
FT   CDS_pept        255161..256345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0235"
FT                   /product="dihydropteroate synthase"
FT                   /EC_number="2.5.1.15"
FT                   /note="KEGG: bha:BH0093 dihydropteroate synthase
FT                   (dihydropteroate pyrophosphorylase); TIGRFAM:
FT                   dihydropteroate synthase; PFAM: dihydropteroate synthase
FT                   DHPS"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61188"
FT                   /db_xref="GOA:C8W3T4"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3T4"
FT                   /inference="protein motif:TFAM:TIGR01496"
FT                   /protein_id="ACV61188.1"
FT                   /translation="MSVTIRNVIVHNKKESLAEIISTGADISGCRLMAPKGVHRLIKLT
FT                   GLSPKQANIIKQQMLSRGGEAAVSRGVIDCSASEAIVLIMGTLKQFDGLVNILKMQPFG
FT                   LPKIGARIKQVLKNLEGRSPVEIDCRGKILLLGERTLIMGILNVTPDSFSDGGSFYNHE
FT                   VAIEHARAMVSEGADIIDLGGESTRPGHESISVEEELDRVIPVLEKLVREIDVPVSIDT
FT                   TKAEVARRALLAGAHLINDQWALRADPDMAHVVAEYDVPLIIMHNQKGTEYNDLMGDMV
FT                   QFFEESIDTAVNAGLAREKIIVDPGIGFGKTLEQNLETMRRLDELSCLGCPVLLGTSRK
FT                   SMIGKVLDLPVDERVEGTAATVTLGIANGADIVRVHNVKEMVRVARMTDAMVRR"
     atgtcggtaa caattcgtaa tgtaattgta cataataaaa aggagtcttt ggcggagata        60
     atatctaccg gtgctgatat atccgggtgt cgcttaatgg ctcctaaagg agtgcacagg       120
     ctaattaagt taaccggctt aagtcccaag caggctaata taattaagca gcagatgttg       180
     agcagaggtg gggaggccgc agtatccaga ggagttatag actgctctgc ctctgaggca       240
     atagtattga ttatgggtac cttaaagcag tttgacggac ttgtgaatat attaaaaatg       300
     cagccctttg gtctgcccaa aatcggtgca cggattaaac aagtattaaa aaacctggaa       360
     ggcagatctc ctgtggaaat agactgccgg ggaaagatcc tccttctggg tgaacgcaca       420
     ttaatcatgg gaattttgaa tgtgactccg gattcttttt cggatggggg aagtttttat       480
     aaccatgaag ttgcaattga acatgccagg gcaatggtgt ccgaaggagc ggacataata       540
     gacttgggag gagagtcaac acgaccgggt catgaatcca tcagtgtgga agaagaatta       600
     gaccgggtaa tacctgtttt ggaaaaactg gttagagaaa ttgatgttcc tgtttccatt       660
     gatacaacca aggcagaagt agcgcgtcgc gctttgcttg ccggtgctca tctgattaac       720
     gatcagtggg ctttaagggc agacccggat atggctcatg tagtagcgga atacgatgtt       780
     cctttaatta tcatgcataa ccaaaaaggt acagagtaca atgatctcat gggtgatatg       840
     gtgcagtttt ttgaagaaag tatagataca gcggtaaatg ccgggttagc cagagaaaag       900
     ataattgttg atcccggcat tggttttggc aaaacgctgg aacagaatct tgaaaccatg       960
     cgaagattag atgaattgtc ttgtttgggt tgtccggtac tcctgggtac ttcgcgtaag      1020
     tcaatgatcg gcaaggttct tgatctgcct gttgatgagc gggtggaggg tactgcggct      1080
     acggtaacac tgggcatagc taacggtgct gatattgtgc gggtgcataa tgttaaagaa      1140
     atggttcgtg tcgccagaat gactgatgcg atggtgagaa gataa                      1185
//

If you have problems or comments...

PBIL Back to PBIL home page