(data stored in ACNUC7421 zone)

EMBL: CP001720.PE224

CP001720.PE224       Location/Qualifiers
FT   CDS_pept        256357..256722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0236"
FT                   /product="dihydroneopterin aldolase"
FT                   /note="TIGRFAM: dihydroneopterin aldolase; PFAM:
FT                   dihydroneopterin aldolase; KEGG: baa:BA_0662
FT                   dihydroneopterin aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61189"
FT                   /db_xref="GOA:C8W3T5"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3T5"
FT                   /inference="protein motif:TFAM:TIGR00525"
FT                   /protein_id="ACV61189.1"
FT                   /translation="MSDKIILSGLDFYGYHGVLPEEQRLGQKFIIDLELSLSLREAGIK
FT                   DDPDLTVNYARVFETVREVVVGKPFFLIEALAEAIAFKVLKNFSIEKVLVRVRKPQAPV
FT                   PGCFEHMAVEITREKEV"
     atgagcgaca aaattatact gagcgggttg gatttttacg gttatcatgg agttttgccg        60
     gaagagcagc ggttaggtca aaaatttatt attgatttgg aactttcttt gagcctgaga       120
     gaagcaggta taaaagatga tcctgatctg actgtaaact atgcccgagt attcgagaca       180
     gtgagagaag tcgttgttgg aaagccgttt tttttgatag aagctttagc tgaggccatt       240
     gcttttaagg ttttgaaaaa cttcagcata gaaaaagttt tagtaagggt aagaaaaccc       300
     caagcaccgg taccaggatg tttcgaacac atggcggtgg aaatcaccag agaaaaagag       360
     gtatga                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page