(data stored in ACNUC7421 zone)

EMBL: CP001720.PE229

CP001720.PE229       Location/Qualifiers
FT   CDS_pept        260831..261676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0241"
FT                   /product="pantoate/beta-alanine ligase"
FT                   /EC_number="6.3.2.1"
FT                   /note="KEGG: gme:Gmet_1643 pantothenate synthetase;
FT                   TIGRFAM: pantoate/beta-alanine ligase; PFAM:
FT                   Pantoate-beta-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61194"
FT                   /db_xref="GOA:C8W3U0"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3U0"
FT                   /inference="protein motif:TFAM:TIGR00018"
FT                   /protein_id="ACV61194.1"
FT                   /translation="MKTIKTIAEAKKFLKQARLQGLTIGLVPTMGYLHEGHLTLMRECK
FT                   KKCDLTVVSIFVNPLQFGPKEDFSGYPRDLGRDSSLAEGVGVDLLFCPEPQEVYPANYS
FT                   TYVDVEGLTGVLCGKSRPGHFRGVTTVVNKLFNIVRPDYAFFGQKDAQQVLVIKKMVRD
FT                   LLMDLEIITVPIVRESDGLALSSRNVYLSREERRAALVLSLSLIMARDAVKSGENNVAL
FT                   LKDRVRQMISAEPLARIDYVEILSLPDLAEINSLEAPALLALAVFFGKTRLIDNVVLES
FT                   "
     gtgaaaacaa taaaaaccat agctgaagcg aaaaaatttt taaagcaggc caggttacag        60
     ggcttaacaa ttggtctggt tcctaccatg gggtatctgc acgaaggaca cctgaccctg       120
     atgcgggagt gtaaaaaaaa gtgcgatttg acggtggtca gtatctttgt taatcctctg       180
     cagttcggac ccaaagagga tttcagcggt tatcccaggg atttggggag agatagctca       240
     ctggcagaag gtgtgggagt tgatttgctt ttttgtccgg aaccgcagga agtatacccg       300
     gccaattaca gtacttatgt ggacgttgag gggttaaccg gcgtactgtg cggtaagtcc       360
     agacccggtc attttcgtgg ggtaactact gttgttaata agttatttaa tattgtaagg       420
     cctgattatg ctttttttgg ccagaaggat gcgcagcagg tactggtgat taaaaagatg       480
     gtgcgtgatt tacttatgga tttggaaatt attacagtac ctattgtcag ggaatccgac       540
     ggtctggcat taagttcccg caatgtttat ttgagtcgcg aagagcgccg tgctgctttg       600
     gtgctgtcgc ttagtttaat tatggcccgg gatgcggtga aatcgggaga aaataatgtt       660
     gcacttttaa aagatagggt aagacaaatg atcagtgcgg agcctttggc caggattgat       720
     tatgtggaaa tactgagtct gccggattta gctgagatta attcgctgga agcaccggct       780
     ttgctggcgc tggctgtttt ttttggtaaa acccgtttga tagataatgt tgtgctggaa       840
     tcataa                                                                  846
//

If you have problems or comments...

PBIL Back to PBIL home page