(data stored in ACNUC7421 zone)

EMBL: CP001720.PE230

CP001720.PE230       Location/Qualifiers
FT   CDS_pept        261742..262125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0242"
FT                   /product="aspartate 1-decarboxylase"
FT                   /EC_number="4.1.1.11"
FT                   /note="KEGG: bsu:BSU22410 aspartate alpha-decarboxylase;
FT                   TIGRFAM: aspartate 1-decarboxylase; PFAM: aspartate
FT                   decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61195"
FT                   /db_xref="GOA:C8W3U1"
FT                   /db_xref="InterPro:IPR003190"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3U1"
FT                   /inference="protein motif:TFAM:TIGR00223"
FT                   /protein_id="ACV61195.1"
FT                   /translation="MFLTMFKSKIHRATVTEANLNYMGSITVDRSLLEAANILPHEKVQ
FT                   IVNNNNGNRFETYTIAGPRDSGVVCLNGAAARMVQQGDTVIIIAYTMLDAEEAKTFQPR
FT                   IVFLDEKNRVERVANGENHGDIG"
     gtgtttttga ctatgtttaa atcaaaaatt caccgggcaa cagttactga ggccaatctt        60
     aactatatgg gaagcattac tgttgaccgg tctttgctgg aagcagccaa tattttgccc       120
     catgagaagg tgcaaatagt taataataat aacggtaaca ggtttgagac atatactatt       180
     gccggtccca gggattccgg tgttgtttgc cttaacggcg cggctgcccg catggtgcag       240
     caaggtgata cagtcattat tattgcttac accatgcttg atgcggaaga agctaagact       300
     tttcagccga ggatagtatt tttagatgag aaaaaccggg ttgaacgggt tgccaatggc       360
     gaaaaccatg gggatattgg gtag                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page