(data stored in ACNUC7421 zone)

EMBL: CP001720.PE231

CP001720.PE231       Location/Qualifiers
FT   CDS_pept        complement(262401..262949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0243"
FT                   /product="BioY protein"
FT                   /note="PFAM: BioY protein; KEGG: baa:BA_0023 BioY family"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61196"
FT                   /db_xref="GOA:C8W3U2"
FT                   /db_xref="InterPro:IPR003784"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3U2"
FT                   /inference="protein motif:PFAM:PF02632"
FT                   /protein_id="ACV61196.1"
FT                   /translation="MKFSARDIALAGMFAALAAIVAVLGRFGITAIVPFSLQPLVVLLA
FT                   GGLLGARLGAMSISVYVLMGLIGLPVFEKPPFGGPAYILQPTFGFLIAFIAAAYVIGKL
FT                   LEGKKSGFGCYFMAMLAGLFIIYAIGLPYFYLIFNFYIGKAMPVMSVIKIAFLPFVGFD
FT                   LLKAIMSASLAMAVSRRIG"
     atgaagtttt cagccaggga tattgcactg gcgggcatgt ttgcggcttt ggccgccatt        60
     gtagctgtct taggcaggtt tggtataacg gccattgttc cctttagcct gcagcccctg       120
     gtggtgctgc tagccggtgg gttgttggga gcccgtttag gtgctatgag catatcggta       180
     tatgtactga tgggtttgat tggtctaccg gtttttgaga agccgccttt tggtggcccg       240
     gcttatatat tgcagccgac atttggcttt ttaatagctt ttatcgcagc tgcttacgtt       300
     attggtaaac ttcttgaggg taaaaaatcc ggctttggct gttactttat ggcgatgctg       360
     gcgggcctat ttataattta tgcaataggt ttgccttatt tttatttgat tttcaatttt       420
     tacataggca aagctatgcc ggtaatgtca gttataaaga ttgctttttt accgtttgta       480
     ggttttgatt tgctcaaagc tattatgtcc gcttccttag ctatggcagt gtcacggagg       540
     attggttag                                                               549
//

If you have problems or comments...

PBIL Back to PBIL home page