(data stored in ACNUC7421 zone)

EMBL: CP001720.PE233

CP001720.PE233       Location/Qualifiers
FT   CDS_pept        complement(264254..264598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0245"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein ArsR; SMART: regulatory
FT                   protein ArsR; KEGG: gur:Gura_0439 regulatory protein, ArsR"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61198"
FT                   /db_xref="GOA:C8W3U4"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3U4"
FT                   /inference="protein motif:PFAM:PF01022"
FT                   /protein_id="ACV61198.1"
FT                   /translation="MEENIIKMKADILKALAHPTRVKILENLREGERCVCEIIDDLGIE
FT                   QSNVSQHLAVLKKLDIVVSRKDGLRVNYQVKHQQIFKLLDLLGSILLSQAENTVSLLKG
FT                   LKRDEGDNTH"
     gtggaagaaa atattattaa aatgaaagct gatattttaa aagcacttgc acatcctacc        60
     cgtgtaaaaa tactagagaa cttgcgcgaa ggagaaagat gcgtttgtga gataattgat       120
     gacctgggca ttgagcagtc aaatgtttca caacatctgg ctgtactaaa aaaacttgat       180
     atcgtagtct caaggaaaga cggtcttagg gtaaactacc aagtaaaaca ccaacaaatt       240
     tttaaactgc tcgaccttct aggcagcatt cttctatccc aggcagaaaa cactgtttct       300
     ttgctcaaag gcctgaaaag ggatgaagga gataatactc actaa                       345
//

If you have problems or comments...

PBIL Back to PBIL home page