(data stored in ACNUC7421 zone)

EMBL: CP001720.PE235

CP001720.PE235       Location/Qualifiers
FT   CDS_pept        265628..266596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0247"
FT                   /product="TIM-barrel protein, nifR3 family"
FT                   /note="TIGRFAM: TIM-barrel protein, nifR3 family; PFAM:
FT                   dihydrouridine synthase DuS; KEGG: bha:BH0097 nitrogen
FT                   regulation transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61200"
FT                   /db_xref="GOA:C8W3U6"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3U6"
FT                   /inference="protein motif:TFAM:TIGR00737"
FT                   /protein_id="ACV61200.1"
FT                   /translation="MLRIGNVTIKNRVISAPMAGITDRAYRILAKEAGCGLVCTEMISD
FT                   QALLYGNPKTNILLDCTGETPPISMQIFGSSPEYMARAASITEARGASIIDINMGCPTP
FT                   KIVKNGEGAALMRKPELAQKIISDVVQSVRVPVTVKIRKGWDESFPNAVEMALLAEEAG
FT                   AKAVTVHGRTRSQFYSGKADWDIIKSVKKAVTIPVIGNGDIREPRDAVRMLMHTGCDAV
FT                   MIGRASLGNPWIFSSTVHFLDCGENLPAPSPRQRLSVALRHLELLIELKGEYIAIREMR
FT                   KHAAWYTRGLREANRIREKINRAVSLSEIRELLNYFILVKN"
     atgttaagaa taggcaatgt tacaataaaa aacagagtaa tctctgcccc aatggcaggc        60
     attactgaca gggcatatcg tattctagct aaagaggctg gttgtggctt agtctgtacg       120
     gaaatgatca gtgatcaggc tttattatat ggcaacccta aaactaatat attattagac       180
     tgtacaggag aaaccccgcc catcagtatg cagatttttg gctccagtcc tgaatatatg       240
     gcacgcgccg ccagtataac agaagcacgg ggggccagta ttattgatat aaatatgggc       300
     tgccccacac ccaagatagt aaaaaacggt gaaggtgcag ccctcatgag aaaacctgaa       360
     ctagcgcaaa aaataataag cgatgttgtg caatctgtac gagtacccgt aaccgttaaa       420
     attaggaaag ggtgggatga atcctttcct aacgccgtgg aaatggcgct tttggccgaa       480
     gaggcgggag caaaggcggt tacagtacac ggccgaacca gatcgcaatt ttacagcggc       540
     aaagctgact gggatattat taaaagtgtt aaaaaggcag taactatacc agttataggc       600
     aacggtgaca ttcgagaacc gcgagacgcc gttcgtatgc ttatgcatac cggttgtgat       660
     gcagtcatga taggacgtgc atctttgggt aacccatgga tattttcttc caccgttcat       720
     tttttggact gcggggagaa tttgccggca ccttctcccc gccaaaggtt atctgtagca       780
     ttgcgccact tggaactgct gatagagcta aaaggtgaat acattgccat acgtgaaatg       840
     cgtaaacatg cagcctggta taccagaggg ctgcgggaag ctaaccgtat aagagaaaaa       900
     attaaccgcg cagtttcttt gagcgaaatt agagaacttc tgaattattt tatactagtt       960
     aaaaattga                                                               969
//

If you have problems or comments...

PBIL Back to PBIL home page