(data stored in ACNUC7421 zone)

EMBL: CP001720.PE241

CP001720.PE241       Location/Qualifiers
FT   CDS_pept        277313..277837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0253"
FT                   /product="UvrB/UvrC protein"
FT                   /note="PFAM: UvrB/UvrC protein; KEGG: bsu:BSU00840
FT                   modulation of CtsR repression"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61206"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR025542"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3V2"
FT                   /inference="protein motif:PFAM:PF02151"
FT                   /protein_id="ACV61206.1"
FT                   /translation="MMCERCQERQANVQFTEIINGKKKTIRLCEVCAKEMHMDNFGWFP
FT                   QLGLHTFLAGLLEHEFGNGNSLKTSPGENISCSKCGLSGEQFAKSGLLGCGYCYDDLAK
FT                   QIDPLLRRIHGNSRHTGKVPERTGGSIRLVKEMENLKAELASCVAREEFERAAVLRDQI
FT                   RLLEKDIYRKG"
     atgatgtgtg aacgctgtca ggagaggcag gctaatgttc agtttactga gataataaat        60
     ggcaagaaaa aaactattcg tttgtgtgaa gtatgtgcca aagaaatgca tatggataat       120
     tttggatggt ttcctcagct tggcctgcat acctttttgg caggtttact ggagcatgaa       180
     tttggtaatg ggaattcatt aaaaacctcc ccgggagaaa atattagttg cagcaaatgc       240
     ggtttatcag gtgaacagtt tgccaagagc gggctgttgg gatgcggcta ttgctacgat       300
     gatttagcca agcaaattga tcccctgctt cgccgcattc acggtaactc caggcatacg       360
     ggaaaggtgc cggagcgtac cgggggcagc attcgcctgg taaaagaaat ggaaaatctc       420
     aaggcggaac ttgcctcttg tgtcgcacgt gaagagtttg aacgggctgc tgtattgcgt       480
     gatcaaataa ggctattgga gaaggacatt taccgaaagg ggtag                       525
//

If you have problems or comments...

PBIL Back to PBIL home page