(data stored in ACNUC7421 zone)

EMBL: CP001720.PE243

CP001720.PE243       Location/Qualifiers
FT   CDS_pept        279032..281464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0255"
FT                   /product="ATPase AAA-2 domain protein"
FT                   /note="PFAM: ATPase AAA-2 domain protein; UvrB/UvrC
FT                   protein; AAA ATPase central domain protein; ATPase
FT                   associated with various cellular activities AAA_5; Clp
FT                   domain protein; SMART: AAA ATPase; KEGG: bha:BH0103 class
FT                   III stress response-related ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61208"
FT                   /db_xref="GOA:C8W3V4"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3V4"
FT                   /inference="protein motif:PFAM:PF07724"
FT                   /protein_id="ACV61208.1"
FT                   /translation="MFDKFTERAKKVFVLAQDEAKRMATPYIGTEHLLLGLIREGEGVA
FT                   AKVLESLNIDAETVRQAVGQLVGPGKGVAQEMFLTPRGKKVLELAIAEARSLGHNYVGT
FT                   EHLLLGLISEGEGVAAQVLNALGADIEQVRSMIMQMLGGGQSSQGGCASGQCGSKAGNV
FT                   QTKALDEYGRDLTEMAREDKLDPVVGREKEIERVIQVLSRRTKNNPVLLGDPGVGKTAV
FT                   VEGLAQRISSGNVPETLLSKRVVSLDLAALVAGTKYRGEFEDRLKKVTQEITKAGNIVL
FT                   FIDELHTLIGAGAAEGAIDAANILKPALARGEMQCIGATTLDEYRKYIEKDAALERRFQ
FT                   PINVEEATVEETIAILKGLRDRYEAHHRVRISDEALVNAAKLADRYISDRFLPDKAIDL
FT                   MDEASSRVRMLAFTAPPDLKDLERKTEKVRKEKEEAINSQEFEKAARLRDQEQSLKKEL
FT                   EDRREAWNLTKGGNELAVSEEDIAHVVASWTGIPVKKLAEEESDRLLKMEEILHQRVIG
FT                   QEEAVRAVSRAVRRARAGLKDPGRPVGSFIFLGPTGVGKTELARALAEALFGDDDALIR
FT                   IDMSEYMEKYAVSRLVGAPPGYVGYEEGGQLTKAVRRKPYSVVLLDEIEKAHPDVFNIL
FT                   LQVLEDGRLTDSQGRAVDFRNTVIIMTSNVGVSHIRKIGSLGFQTAENDSYSKMKGDVT
FT                   QELRKTFRPEFLNRVDETIVFHSLEQKHLNEIVGLMLKDVLGRLAENEIKVEATEAAKE
FT                   LLASKGFDETYGARPLRREIQKQVEDRLSEELLKGAVKKGEHVVLNVVDGEILIEKK"
     atgtttgata aatttacgga acgtgctaag aaagtattcg tgctggcaca agacgaggcc        60
     aaaaggatgg ctactccata tatcggtacg gagcatttgc tgcttggatt aatccgtgag       120
     ggtgagggtg ttgctgcaaa agtgttggag tcacttaata ttgatgcgga aacagttcgc       180
     caagcggtag ggcagcttgt cggtccaggc aaaggtgtag ctcaggaaat gtttctgaca       240
     cctcgcggca aaaaagttct tgaactggct atagctgaag ccaggagttt aggacataat       300
     tatgttggca ccgaacatct tttgctggga ttaatcagcg agggcgaagg agtggcagca       360
     caggtattaa acgccttggg tgctgatatt gaacaggtac gcagtatgat tatgcagatg       420
     ttgggtggag ggcagtcgtc gcagggtggc tgcgcttccg gccagtgcgg cagcaaagct       480
     gggaatgttc agacaaaggc cctggatgag tacggtcgtg atttgacaga aatggctcgc       540
     gaagataagc ttgaccctgt agtcggaaga gaaaaagaaa ttgagagagt tatacaggta       600
     ttaagccgca gaactaaaaa taaccctgtt ttgcttggtg atccgggagt agggaaaacc       660
     gctgttgtag agggtttagc ccagcggata tcttccggca acgttcctga gacgctgctc       720
     tcaaaaaggg tcgttagttt ggatttagct gctctggttg ccggcaccaa gtacagggga       780
     gaatttgaag accgtttaaa aaaagtgaca caagaaatta ctaaagcggg caacatagta       840
     ctgtttattg atgagctgca tactttgata ggtgccggtg ccgcagaagg tgccatagac       900
     gcggcaaata tattaaaacc cgctttagca cggggcgaaa tgcaatgcat tggagctaca       960
     acattggatg agtatcgcaa gtatatagaa aaagatgcgg cactggaacg gcgtttccaa      1020
     ccaattaatg ttgaagaggc aacggtggaa gaaaccattg ctattcttaa gggattaaga      1080
     gataggtatg aagcccatca ccgtgttcgt atcagtgatg aggctctggt taatgcagct      1140
     aagctggctg accgctatat atcagatcgg tttttgccgg ataaggccat agatttaatg      1200
     gacgaagcaa gttccagagt tcgtatgctg gcttttactg caccaccgga cttaaaagat      1260
     ctggagcgta aaacggaaaa ggtgcggaag gagaaagaag aggctattaa cagccaggaa      1320
     tttgaaaaag cggcccggct aagggatcag gagcagtccc tgaagaagga actggaagac      1380
     cgccgggaag cctggaatct aacaaaaggc ggcaatgaac tggctgtcag tgaagaagat      1440
     attgctcatg ttgtagcttc ttggacaggt atacctgtta aaaagctggc cgaagaagag      1500
     tcggatagac ttttgaaaat ggaagaaata ctgcatcaaa gggtaatcgg tcaggaggaa      1560
     gctgttcggg cagtttcccg tgctgtacgc cgtgcacggg caggcctaaa agatcctggc      1620
     cgtcctgtag gctcctttat tttcctgggt cctaccgggg tgggcaaaac tgagttagcc      1680
     agagcactgg ccgaagctct ttttggcgat gatgatgcct tgattcgcat agatatgtct      1740
     gaatacatgg agaagtatgc ggtatccagg ctggttggcg ctcccccagg ctatgtaggg      1800
     tatgaagagg gaggtcaact gaccaaggcg gttaggagga agccttattc agtagtattg      1860
     ctggatgaaa tagagaaggc gcatccggat gtttttaaca ttctcctaca agttctggaa      1920
     gatgggcggc ttactgattc tcagggtcgt gcggtggatt tccgcaatac tgttattatt      1980
     atgacttcta atgtcggagt aagtcatata agaaagattg gctcgcttgg ttttcaaacc      2040
     gccgaaaatg acagctatag taaaatgaag ggcgatgtta cccaggaatt gcgtaaaact      2100
     tttcggccgg aatttctcaa tagggtggat gagactattg tgttccactc cttagagcag      2160
     aaacatctaa atgaaattgt cggtctgatg ctaaaagatg tgcttggccg attggcggaa      2220
     aacgaaatca aagtggaagc gacggaagca gctaaagaac tcttagccag taagggcttt      2280
     gatgaaacat atggtgcccg ccccctgcgc cgtgagattc aaaaacaggt tgaggataga      2340
     ctatccgaag aattattaaa aggagcggtt aaaaaaggag aacatgttgt actcaatgtg      2400
     gtggatggcg agattttaat tgagaaaaaa taa                                   2433
//

If you have problems or comments...

PBIL Back to PBIL home page