(data stored in ACNUC7421 zone)

EMBL: CP001720.PE244

CP001720.PE244       Location/Qualifiers
FT   CDS_pept        281610..282983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0256"
FT                   /product="DNA repair protein RadA"
FT                   /note="TIGRFAM: DNA repair protein RadA; SMART: AAA ATPase;
FT                   KEGG: bha:BH0104 DNA repair protein RadA"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61209"
FT                   /db_xref="GOA:C8W3V5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3V5"
FT                   /inference="protein motif:TFAM:TIGR00416"
FT                   /protein_id="ACV61209.1"
FT                   /translation="MKQKTIYCCQECGSQSPRWVGRCPSCEAWNSMVEEMPVKSAGAVL
FT                   RGKTEPVRQPVLLTEVLLYAENRIPTGIKEMDRVLGGGIVPGSLILLGGEPGIGKSTLL
FT                   LQVAFLIGKDNREVIYVCGEESMQQVRLRAERLNSISENVLLLAENNVDRVELQIKERK
FT                   PFLVIIDSVQTIYKESLSSSPGSVGQVRECASQLMRLAKMMDTAIFLVGHVTKDGAIAG
FT                   PKVLEHMVDAVLYFEGERHQSFRLLRGVKNRFGSTNEIGIFNMAGNGLIEATNPSSLFM
FT                   QHWQVPVPGSVIVPTIEGTRPLLVEIQALVCPTGFGLPRRMATGVDYNRVALIIAVLER
FT                   RLGYQLSKYDIYVNAVGGVKIEEPAVDLSIALAIASSFHDRPLGLGLAVAGEIGLTGEV
FT                   RPVASIEKRLSEAGELGFKKTIVPEANINPAIDCKSKAVGVKTVTEAVQVALQSGGIV"
     atgaaacaaa agaccatcta ttgctgccag gaatgtggta gtcaaagccc tcgttgggta        60
     ggtcgctgcc cgtcttgtga ggcttggaat tctatggtgg aagagatgcc cgttaaaagt       120
     gcgggtgcgg ttctgcgggg gaaaacagag cctgtcaggc agccggtttt gttaacagag       180
     gtactgctat atgcagaaaa tcgcatacct accggtatta aggaaatgga tcgcgtattg       240
     ggtggtggca ttgtgccggg ctctttaatt ttattgggcg gtgagcctgg tataggcaaa       300
     tccacgcttc ttttgcaggt agctttttta ataggcaaag ataataggga agtcatatat       360
     gtctgtggtg aggaatcaat gcagcaggtt cgtttgcggg cggagcggct taattccata       420
     agcgaaaacg tattgctttt agcggaaaat aatgtggacc gggttgaatt gcagataaaa       480
     gagcgcaagc catttttggt tataattgat tcggttcaga caatatataa agaaagcctc       540
     tcttcttctc ccggcagtgt tggtcaagtt agggagtgtg cctcacagct aatgaggctg       600
     gcaaaaatga tggacacagc tatttttttg gtcggtcatg tgacaaagga cggggcaatt       660
     gccggtccta aagtgcttga gcatatggta gatgctgttt tgtattttga gggagagagg       720
     caccagtctt tccgcttgct gagaggagtt aaaaatcgtt ttggttcgac caatgaaata       780
     ggtattttta atatggcagg taatggttta attgaagcaa ctaatcccag ttctttattc       840
     atgcagcatt ggcaggtacc cgtacccggt tcagttatag tccctacgat agaggggact       900
     cggcctcttc tggtagagat tcaggcattg gtttgtccaa caggttttgg tttgcccagg       960
     cgtatggcaa caggtgtcga ctataatcgg gtggccttaa tcatagcagt tttggagaga      1020
     agattaggat accaattaag taagtatgat atttatgtaa atgctgtggg cggtgtgaaa      1080
     atagaggaac ccgcggtaga tttgagtatt gctttggcca tagcctccag ttttcatgat      1140
     cgcccattgg ggttggggtt ggctgtggca ggtgaaattg gccttaccgg ggaggtcaga      1200
     cctgtagctt ctatagaaaa aagactgtct gaggccggag agctcggatt taagaaaact      1260
     atagttcctg aagctaatat aaatcctgcc attgattgta aatcaaaagc agtgggagtg      1320
     aaaactgtga ctgaggctgt tcaagtagcc ttgcagtctg gggggattgt gtaa            1374
//

If you have problems or comments...

PBIL Back to PBIL home page