(data stored in ACNUC7421 zone)

EMBL: CP001720.PE247

CP001720.PE247       Location/Qualifiers
FT   CDS_pept        284699..285175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0259"
FT                   /product="transcriptional regulator, CarD family"
FT                   /note="PFAM: transcription factor CarD; KEGG: sat:SYN_00997
FT                   CarD-like transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61212"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR042215"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3V8"
FT                   /inference="protein motif:PFAM:PF02559"
FT                   /protein_id="ACV61212.1"
FT                   /translation="MFKIGDKVVYPMHGAGVIEAIEEKEVLGEIKHYYILRLPIGNMKV
FT                   MIPIDHGRDVGLRQVITRDDVQMVLRILSDKSTSMPPNWNRRYRANLEKIKSGNIYEVA
FT                   EVVRNLIKRDKEKGLSSGERKMLENARQILISELVLATELEEDKAQSLVDGVFA"
     ttgttcaaaa ttggtgacaa ggttgtctat cctatgcacg gtgccggagt cattgaggct        60
     attgaggaaa aagaagtgct gggtgaaata aagcattatt atattttgag gctcccaata       120
     ggaaatatga aagtaatgat tcctattgac cacggtaggg atgtgggatt gagacaggtc       180
     atcacccggg acgatgtaca aatggttttg cgaattttat cagataaatc caccagtatg       240
     ccccccaact ggaaccgtag gtaccgagcc aatttggaaa aaattaagag cggtaatatt       300
     tatgaagttg cagaagtggt aagaaacctt attaagaggg ataaagaaaa gggtttgtcc       360
     tccggggaaa gaaaaatgct ggagaatgcg cgtcagattt taattagtga attggtgttg       420
     gcaacagaac tggaagaaga taaggctcaa tcactggttg acggggtttt tgcttag          477
//

If you have problems or comments...

PBIL Back to PBIL home page