(data stored in ACNUC7421 zone)

EMBL: CP001720.PE248

CP001720.PE248       Location/Qualifiers
FT   CDS_pept        285368..286519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0260"
FT                   /product="PilT protein domain protein"
FT                   /note="PFAM: PilT protein domain protein; SMART: Nucleotide
FT                   binding protein PINc; KEGG: baa:BA_0673 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61213"
FT                   /db_xref="GOA:C8W3V9"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3V9"
FT                   /inference="protein motif:PFAM:PF01850"
FT                   /protein_id="ACV61213.1"
FT                   /translation="MVKRVVFFLLVALFAAGGFFSGYYVVESGIIDFSGSSLNLRVGVF
FT                   ALATLIGVVVGILAAPWIIKSTVWATAKIERYFQKTPTQDLVMGSIGLITGLIIASLFF
FT                   NILPNWGWVSVIKVLGAILLGYLGMSLGVKKREEIFGLFATIPKFGKEKLSKSDSKANV
FT                   DKILDTSVIIDGRIADLCASGFIEGTLMIPVFVLEELRHIADSPDLLKRNRGRRGLDIL
FT                   NNLRKNSDIKVQIYENTRGLENVPEVDMKLVKLAQKLGIKVMTNDYNLNKVAELHGVKV
FT                   LNINELANAVKPIVLPGEEMVVQVVKDGKESGQGVAYLDDGTMIVVDGGRKYIGQTIVV
FT                   VVTSVLQTAAGRMIFAKSKNELKKGENGGGQLSYNEVNYFESN"
     atggttaaaa gagtggtgtt ctttttattg gtagctcttt ttgcggcggg tggatttttt        60
     tccgggtact atgttgtaga gtcaggaatt atagattttt ccggttcctc attaaactta       120
     agagtgggag tattcgctct ggctactctg attggggtag ttgttgggat tttggcagct       180
     ccttggataa taaaaagtac ggtttgggca acagctaaga tagaacgtta ttttcaaaaa       240
     actccaacgc aggatcttgt catgggatcc attggcttga ttactggact tataattgct       300
     agtttatttt ttaatattct ccccaactgg ggatgggttt ccgttataaa agtactcggc       360
     gcgattctac ttggttatct gggtatgagt ttgggcgtta aaaaaagaga agaaatattt       420
     ggtttatttg ccactatccc aaagtttggt aaggaaaagc tctcaaaatc tgacagcaag       480
     gctaatgtcg ataagatatt agataccagt gtgattatcg acgggagaat tgctgattta       540
     tgtgccagcg gctttataga gggaacactc atgatacctg ttttcgtgct ggaagaattg       600
     cgtcatattg ctgattctcc cgatctattg aagcgaaaca gggggcgtag aggcttggat       660
     attttgaata acctgcgtaa aaactctgat attaaagtgc agatttatga aaatacccgt       720
     ggtttggaaa atgtccccga ggtggatatg aaactggtta aattagccca gaaactagga       780
     attaaggtaa tgaccaatga ttataatttg aataaagttg ccgaattgca cggtgttaag       840
     gtattaaata ttaatgagct ggccaatgct gttaagccga ttgtattgcc aggagaagag       900
     atggtggtgc aggttgtaaa ggatggcaag gaatccggcc agggtgtggc ttatcttgat       960
     gacggtacta tgatagtagt tgacgggggt agaaaatata taggacaaac aattgtggtt      1020
     gtggttacca gtgttcttca gacagctgcg gggcggatga tttttgccaa gtccaaaaat      1080
     gagcttaaaa aaggtgaaaa cggtggtggg cagttgtctt ataacgaggt gaattatttt      1140
     gagtctaatt ag                                                          1152
//

If you have problems or comments...

PBIL Back to PBIL home page