(data stored in ACNUC7421 zone)

EMBL: CP001720.PE25

CP001720.PE25        Location/Qualifiers
FT   CDS_pept        27663..29606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0026"
FT                   /product="ferredoxin"
FT                   /note="PFAM: ferredoxin; KEGG: sit:TM1040_1226 ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACV60990"
FT                   /db_xref="GOA:C8VVC5"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR027980"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR040506"
FT                   /db_xref="InterPro:IPR041414"
FT                   /db_xref="InterPro:IPR042259"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVC5"
FT                   /inference="protein motif:PFAM:PF00111"
FT                   /protein_id="ACV60990.1"
FT                   /translation="MKYNVVFQPSGRRGMVVEGISLLQASRDLGADIEGPCGGTGKCGK
FT                   CKVKIEEGYFEKYSITSQSSNLLPLTEQEKAVLTPDEQLDHYRLACCAIIQGDVLVFVP
FT                   EQSSQAKQVILESSRGRSANLNPAVKKYYIEMKKATLDDYRDDYMRLKNALIENYSHLK
FT                   DEFSVDYKVLLTLPNVLRESGWKVTVTLWNERNVIAVEPGRVEEAYGIAVDIGTTTIAA
FT                   YLCDLNTGMLLKRDSLMNSQVRYGDDVISRISYCMMNEDGLARLHNLIIEDINKLIERM
FT                   AEAAHVNCENIYELVLVFNTAMHHITLNIDPRYMGSSPFVSVIREPVDIKARELGIKIA
FT                   EGGNVHCLPVEAGFVGADNVSVLIAEEPYKQDKMMLLIDIGTNGEINLGNRDCIMSTSC
FT                   ATGPALEGAQIKHGMRAAPGAIEGVKIDRHSFEPECKVIGGGVNSSSQTGYIKGICGSG
FT                   IIDAVACLFKAGIILPDGSFNKKLDIPRLRRSSEGKMEYVLVWAAETSAGQDITITQKD
FT                   VRAVQLAKAALYAGAKILMQKRDVNKLDGVVLAGAFGSYINKESALLIGMFPDCALENV
FT                   IAVGNAAGEGARLALLDKDKRLEAKEAASFVKFVETAAEADFQKHFFEAMYFPHAKDSF
FT                   PHMQNILDGEEK"
     atgaaatata acgttgtttt tcaaccgtcg ggacgccggg gtatggtggt tgagggtata        60
     agcctccttc aggcttcccg ggatctgggc gccgatatcg aaggaccctg cggcggtacc       120
     ggaaaatgcg gcaagtgcaa ggtaaaaatt gaggaaggct attttgagaa gtacagtata       180
     acttcacaaa gctcaaatct tttgccgttg accgagcagg aaaaggccgt gctcacacct       240
     gatgagcagc ttgatcatta tagattagcc tgctgtgcaa taattcaagg agatgtcctg       300
     gtctttgttc ccgagcaaag cagccaggcc aaacaagtaa ttttggaaag ttcgcggggt       360
     agaagcgcca atttaaatcc tgccgtaaaa aaatattata tagagatgaa aaaggcgact       420
     ctggatgatt acagggatga ttatatgcgg cttaaaaatg ctttaataga aaattacagt       480
     cacttgaagg atgaattttc tgtagattac aaggttttgt taacattgcc gaatgttttg       540
     agagaaagcg gttggaaggt aactgtcacc ctgtggaatg agagaaatgt aattgctgtg       600
     gagccggggc gggtggaaga agcttacggt attgctgttg atattggaac aaccactata       660
     gctgcttatc tttgtgattt aaacacgggc atgcttttaa aacgtgactc gctgatgaat       720
     tcccaggttc gctatggcga tgatgtaatc tcgcgtatat cctattgcat gatgaatgag       780
     gatggtttgg ccagactgca caatctgatt attgaagata taaacaagct gatagaacga       840
     atggcggaag ccgcgcatgt taattgtgaa aatatatatg aattggttct tgtttttaac       900
     accgccatgc atcacataac cttaaatatc gatccgagat atatggggag ttcccctttt       960
     gtgtctgtta taagagagcc tgtagatatt aaagcaagag aattgggtat aaaaattgcc      1020
     gaaggcggta atgttcactg tctcccggtt gaggccggtt ttgttggggc tgataatgtt      1080
     tccgtactaa ttgctgaaga gccgtataaa caggataaaa tgatgcttct tatagacata      1140
     gggaccaatg gtgaaattaa tcttggtaat agagattgta taatgtcgac ctcgtgcgct      1200
     accgggcctg ctctggaggg agctcaaata aaacatggca tgagggctgc tcccggcgca      1260
     atagaagggg ttaagattga ccggcattct tttgagcctg aatgcaaagt tattgggggg      1320
     ggagttaata gcagctcaca gacgggatat ataaaaggta tttgtggttc gggtattatt      1380
     gatgcagttg cctgtttgtt taaagcaggt attatcctgc cggacggtag tttcaataaa      1440
     aagcttgata ttccgaggct gcgccggagt tcagaaggga aaatggagta tgtgctggtc      1500
     tgggccgccg agacatctgc cggacaggac ataacgataa cacaaaaaga tgttcgtgcg      1560
     gttcaattgg ctaaagccgc tttatatgca ggagcaaaaa ttcttatgca aaaaagggat      1620
     gtcaataaac tggatggtgt tgttttggcc ggagcctttg gcagttatat aaataaggaa      1680
     agtgctctgc tgattggcat gtttcctgat tgtgctttag aaaatgttat tgctgttggt      1740
     aacgccgcgg gagaaggggc cagactggcc cttttggata aggataagcg tttagaagct      1800
     aaagaggctg cttcctttgt taaatttgtt gagacagcgg cggaagcaga ttttcagaaa      1860
     catttttttg aggctatgta tttcccccat gctaaagact ccttccccca tatgcagaat      1920
     attcttgacg gagaagaaaa atga                                             1944
//

If you have problems or comments...

PBIL Back to PBIL home page