(data stored in ACNUC7421 zone)

EMBL: CP001720.PE252

CP001720.PE252       Location/Qualifiers
FT   CDS_pept        289257..289937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0264"
FT                   /product="serine O-acetyltransferase"
FT                   /EC_number="2.3.1.30"
FT                   /note="TIGRFAM: serine O-acetyltransferase; KEGG:
FT                   baa:BA_0677 serine O-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61217"
FT                   /db_xref="GOA:C8W3W3"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR010493"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3W3"
FT                   /inference="protein motif:TFAM:TIGR01172"
FT                   /protein_id="ACV61217.1"
FT                   /translation="MFDRLRNEIRAVFERDPAAKNILEVILCYPGLHAILIHRIAHSLY
FT                   KKRWFVLARFISQISRFLTGIEIHPGAKIGEGLFIDHGSGVVIGETTEIGDNVTIYQGV
FT                   TLGGTGKEKGKRHPTIGNNVVISAGARILGSFEVGDNAKIGAGSVVLKAVPSNSTVVGV
FT                   PGKIVVRDGQRVGDTHSNIDLRHDQLPDPISEMLLVMQGRINDLEDRLKAHEKKDGISN
FT                   KLEL"
     atgttcgacc gtttgcgaaa cgaaataagg gcagtttttg aacgtgatcc agccgctaag        60
     aatatactgg aggttatcct ttgttatccg gggttgcacg cgatcctgat tcatcgtatt       120
     gcacattcac tatacaagaa gcgctggttt gttttagctc gcttcatatc acaaatctcc       180
     agatttttaa ccggaataga aattcacccg ggagctaaaa ttggtgaagg actttttatt       240
     gaccacggat caggcgtagt cataggtgaa acaacggaaa tcggagataa tgtgacaatt       300
     tatcagggtg ttactctggg gggcacaggc aaggaaaagg gcaagcgcca cccgactatc       360
     ggaaataatg tggtgattag tgccggtgcc agaatcctgg gtagttttga agtgggtgac       420
     aatgccaaaa taggggcggg ctcagttgtt ttgaaggctg tgccgtctaa tagcactgta       480
     gtgggtgtgc cgggtaaaat agtggtgcgt gacggacaaa gggtagggga tacacattct       540
     aatatagatt taagacacga tcaattgccg gatccaataa gtgaaatgtt gctggtaatg       600
     cagggtagaa ttaatgattt ggaagacagg cttaaagcgc atgagaagaa ggatgggata       660
     agcaataaac ttgagcttta a                                                 681
//

If you have problems or comments...

PBIL Back to PBIL home page