(data stored in ACNUC7421 zone)

EMBL: CP001720.PE256

CP001720.PE256       Location/Qualifiers
FT   CDS_pept        292866..293378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0268"
FT                   /product="protein of unknown function DUF901"
FT                   /note="PFAM: protein of unknown function DUF901; KEGG:
FT                   bha:BH0114 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61221"
FT                   /db_xref="InterPro:IPR010298"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3W7"
FT                   /inference="protein motif:PFAM:PF05991"
FT                   /protein_id="ACV61221.1"
FT                   /translation="MKEYLVIDGYNVIYTWPKLARLSDTSLEHARVKLVDIMASHSALS
FT                   GQLIKVVFDAHQVKNITQRQEQVNGIEILYTQQGETADALIERITGDLIKLGKVYVVTS
FT                   DWDEQRIIFGRGAYRMTPRELWEQVKKIRQKNMSEYSINLPTEGYLENRLNESVRDLLE
FT                   KLRRKKF"
     atgaaagagt acctggttat tgatgggtat aatgtaatat atacttggcc caaattagca        60
     agactgtccg atacaagcct agagcatgcc agagttaaac ttgtcgatat aatggccagt       120
     cactcagccc tgtcagggca actgattaaa gttgtttttg atgcccacca ggtgaaaaat       180
     atcacgcaac gacaggaaca ggttaacggt attgaaatac tatataccca gcaaggggaa       240
     accgcagatg cgctaatcga aagaataacc ggagatttaa ttaagctcgg taaggtttat       300
     gtagtaactt ccgattggga tgaacaaaga atcatatttg gtcgcggggc ttaccggatg       360
     acaccgaggg aattatggga acaggttaaa aagatacgtc aaaaaaatat gtctgaatat       420
     tcaataaatc ttcccactga gggatacctt gaaaacaggc taaatgaaag tgttcgtgat       480
     ttattggaaa aattgcggag aaaaaagttc tga                                    513
//

If you have problems or comments...

PBIL Back to PBIL home page