(data stored in ACNUC7421 zone)

EMBL: CP001720.PE258

CP001720.PE258       Location/Qualifiers
FT   CDS_pept        295055..296257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0270"
FT                   /product="translation elongation factor Tu"
FT                   /note="TIGRFAM: translation elongation factor Tu; small
FT                   GTP-binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor Tu domain protein;
FT                   elongation factor Tu domain 2 protein; KEGG: bsu:BSU01130
FT                   elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61223"
FT                   /db_xref="GOA:C8W3W9"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3W9"
FT                   /inference="protein motif:TFAM:TIGR00485"
FT                   /protein_id="ACV61223.1"
FT                   /translation="MAKAKFERTKPHVNIGTIGHVDHGKTTLTAAITVCLATVGQATVK
FT                   KYDEIDNAPEERERGITINTAHVEYETSQRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VVSAADGPMPQTREHILLSRQVGVPYIVVFLNKADMVDDPELLELVDMEVRELLSMYEF
FT                   PGDDTPIIAGSGLKALECACGKRECEWCGKVWELMDAVDEYIPTPMRDKDKPFLMPVED
FT                   VFTITGRGTVATGRVERGQVKIGDAIEIVGLQDEPRKTVVTGVEMFRKLLDYAEAGDNV
FT                   GCLLRGVDRKEIERGQVLAKPGSIKPHTKFNAEVYVLSKEEGGRHTPFFNGYRPQFYFR
FT                   TTDVTGIVKLPEGVEMVMPGDNIKVDIDLITPIAIEEGLRFAIREGGRTVGAGVVTGIN
FT                   E"
     atggcaaaag caaaatttga gcggactaaa ccgcacgtta acattggcac aatcggtcac        60
     gtagaccatg gcaagaccac attgacagcg gcaataaccg tatgtttagc tacagtaggc       120
     caggctacag ttaagaaata tgacgaaatc gataacgctc ctgaagaaag agaacgcggc       180
     atcaccatca acacagcgca cgtagaatat gaaaccagcc agcgccacta tgcgcacgta       240
     gattgcccgg gacacgccga ctatgtaaag aacatgatta ccggcgcagc gcaaatggac       300
     ggagcaatcc tggtagtgtc agcggcggac ggcccgatgc cgcagaccag agaacatatc       360
     ctcttatcca gacaggtagg tgtaccctac atcgtagtat tcttgaacaa ggctgacatg       420
     gtagatgatc ctgaactgtt agagttggta gatatggaag taagagagct tctttccatg       480
     tatgaatttc ccggagatga cacaccgatc atcgcaggtt ccggcttaaa agctttagaa       540
     tgcgcctgcg gcaaaagaga atgcgaatgg tgcggcaaag tatgggaact gatggatgcg       600
     gtagatgaat acattcccac cccgatgcgc gataaagata agcctttctt aatgccggta       660
     gaagacgtat tcaccattac cggacgcggt acagtagcca cgggaagagt ggagcgcggc       720
     caggtgaaaa tcggtgatgc catagaaatc gttggtttgc aggatgagcc gagaaaaaca       780
     gtagtaaccg gcgtagaaat gttccgcaaa ctgcttgact acgcagaagc aggtgacaac       840
     gtgggttgtt tactgcgcgg cgtggacaga aaagaaatcg aacgcggtca agtactggct       900
     aagccaggca gcatcaagcc ccacaccaag tttaacgcgg aagtgtatgt gcttagtaaa       960
     gaagagggtg gccggcatac cccgtttttc aacggctaca gaccccagtt ttatttccgt      1020
     accactgacg tgaccggtat tgtgaagctt ccggaaggcg tggagatggt aatgccggga      1080
     gacaatatca aggtggatat tgatttgatt acgcctattg ctattgaaga aggtctgcgc      1140
     tttgctattc gtgaaggcgg cagaactgtg ggcgccggtg ttgtaacagg tattaatgag      1200
     taa                                                                    1203
//

If you have problems or comments...

PBIL Back to PBIL home page