(data stored in ACNUC7421 zone)

EMBL: CP001720.PE26

CP001720.PE26        Location/Qualifiers
FT   CDS_pept        29729..30565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0027"
FT                   /product="Pyrrolysine-tRNA ligase"
FT                   /note="PFAM: tRNA synthetase class II (G H P and S); KEGG:
FT                   wpi:WPa_1006 threonyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACV60991"
FT                   /db_xref="GOA:C8VVC8"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR023877"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVC8"
FT                   /inference="protein motif:PRIAM:6.1.1.26"
FT                   /protein_id="ACV60991.1"
FT                   /translation="MSFLWTVSQQKRLSELNASEEEKNMSFSSTSDREAAYKRVEMRLI
FT                   NESKQRLNKLRHETKRPAICALENRLAAALRGAGFVQVATPVILSKKLLGKMTITDEHA
FT                   LFSQVFWIEENKCLRPMLAPNLYYILKDLLRLWEKPVRIFEIGSCFRKESQGSNHLNEF
FT                   TMLNLVEWGLPEEQRQKRISELAKLVMDETGIDEYHLEHAESVVYGETVDVMHRDIELG
FT                   SGALGPHFLDGRWGVVGPWVGIGFGLERLLMVEQGGQNVRSMGKSLTYLDGVRLNI"
     atgtcatttt tatggactgt gtcgcaacaa aaaagactta gtgaattaaa cgcttccgaa        60
     gaagagaaaa atatgagctt ttcttcgacg tcagacaggg aagcagctta taaaagagtt       120
     gagatgcggt tgattaatga aagcaaacag cgtttgaata aactaagaca cgaaaccaaa       180
     agacctgcca tttgtgcttt ggaaaatcgc ctggcggcag ccctgagggg tgcaggtttt       240
     gtgcaagttg caacgcccgt tatactttct aaaaagttgt tggggaagat gactattact       300
     gatgagcatg cacttttctc acaggtcttt tggattgaag aaaataaatg cctgcgtccc       360
     atgcttgccc cgaacttgta ttatattcta aaggatttgt tgaggctctg ggaaaaaccg       420
     gttcgcatct ttgagattgg ctcttgtttt cgcaaggaat cacagggcag caatcattta       480
     aatgaattta ctatgcttaa cctggttgaa tggggcttgc cggaagaaca gcgccagaag       540
     aggatcagtg aattggctaa attagtaatg gatgaaaccg gtattgatga ataccatttg       600
     gaacacgcgg aatcagtagt ctatggtgaa accgtggatg ttatgcatag agacatagaa       660
     ttgggttccg gcgctcttgg cccgcacttt cttgatgggc gctggggcgt tgttggtccc       720
     tgggtaggca ttggttttgg cctggaacgc ctgcttatgg ttgaacaggg cggacagaat       780
     gttcgcagca tgggcaaaag cctgacttat ttggacgggg taaggctaaa tatctga          837
//

If you have problems or comments...

PBIL Back to PBIL home page