(data stored in ACNUC7421 zone)

EMBL: CP001720.PE264

CP001720.PE264       Location/Qualifiers
FT   CDS_pept        299090..299617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0276"
FT                   /product="ribosomal protein L10"
FT                   /note="PFAM: ribosomal protein L10; KEGG: gbm:Gbem_0924
FT                   ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61229"
FT                   /db_xref="GOA:C8W3X5"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3X5"
FT                   /inference="protein motif:PFAM:PF00466"
FT                   /protein_id="ACV61229.1"
FT                   /translation="MPTKKEKEIFVEVVYDKMRSCKSAILADYRGLTVSAVTELRNKLR
FT                   ESNSDLKVAKNTLIKIAVDKIGIEGLDPYLEGPTAIAFGYDDPVAPAKILSEFARTNKD
FT                   LEIKGGVLEGRVITADGVKGLASLPSREVLLGKVLGGMQAPLYGFANVLQGNIRNFVYV
FT                   LEAVRKQKAGEA"
     ttgccgacaa aaaaggaaaa agagatattt gtagaagtgg tttatgataa aatgcgctca        60
     tgtaagtctg ctatactggc tgactacagg gggttaaccg tttctgccgt aacagaactg       120
     agaaacaaac tgagagaaag caattcggat ttgaaagtgg ccaaaaatac tctgatcaaa       180
     atcgcggtag acaagatagg cattgaagga ctcgatcctt acctggaggg acctaccgct       240
     atagcttttg ggtatgatga tccggtggca cctgcaaaaa ttttgagtga gtttgcccgt       300
     acaaacaagg atctggaaat taagggcggt gtgttggaag gccgcgtaat tacagccgat       360
     ggtgtaaaag gattggccag tttgccttca cgtgaggttc ttctgggcaa agttcttggc       420
     ggtatgcagg ctccgctata tggttttgca aatgtactgc aaggaaatat acgcaatttt       480
     gtctatgtgc ttgaggctgt tcgcaagcaa aaagcaggcg aagcatag                    528
//

If you have problems or comments...

PBIL Back to PBIL home page