(data stored in ACNUC7421 zone)

EMBL: CP001720.PE265

CP001720.PE265       Location/Qualifiers
FT   CDS_pept        299691..300071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0277"
FT                   /product="ribosomal protein L7/L12"
FT                   /note="TIGRFAM: ribosomal protein L7/L12; PFAM: Ribosomal
FT                   protein L7/L12; KEGG: bha:BH0122 50S ribosomal protein
FT                   L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61230"
FT                   /db_xref="GOA:C8W3X6"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3X6"
FT                   /inference="protein motif:TFAM:TIGR00855"
FT                   /protein_id="ACV61230.1"
FT                   /translation="MSKINEILEAVKGLTVLELSELVKAFEEEFGVTAAAPVGVMAAAP
FT                   AAGAAAAEVEEQTEFDVILTSVGDKKINVIKVVREITGLGLKEAKEVVDNAPKPIKEKV
FT                   SKEEAESMKAKLVEAGASVEIK"
     atgtctaaaa tcaatgaaat tctggaagcc gttaaagggc ttaccgtgct tgagttatct        60
     gaactggtta aagcttttga ggaagagttt ggtgtgaccg ctgctgctcc ggttggcgtt       120
     atggcagctg cacctgctgc cggagccgct gcagctgaag tagaagagca gaccgaattt       180
     gatgttattt taacatctgt aggcgataag aaaatcaacg taattaaggt tgtgcgtgaa       240
     ataaccggac tcggcctgaa agaggccaag gaagtagttg acaacgctcc caagccgatt       300
     aaagaaaaag taagcaagga agaagccgaa tcaatgaagg caaagttagt tgaagcaggc       360
     gcgtccgtgg aaatcaagta a                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page