(data stored in ACNUC7421 zone)

EMBL: CP001720.PE267

CP001720.PE267       Location/Qualifiers
FT   CDS_pept        304234..307761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0279"
FT                   /product="DNA-directed RNA polymerase, beta' subunit"
FT                   /note="KEGG: baa:BA_0690 RNA polymerase alpha subunit;
FT                   TIGRFAM: DNA-directed RNA polymerase, beta' subunit; PFAM:
FT                   RNA polymerase Rpb1 domain 1; RNA polymerase Rpb1 domain 5;
FT                   RNA polymerase Rpb1 domain 3; RNA polymerase alpha subunit;
FT                   RNA polymerase Rpb1 domain 4; SMART: RNA polymerase I
FT                   subunit A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61232"
FT                   /db_xref="GOA:C8W3X8"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3X8"
FT                   /inference="protein motif:TFAM:TIGR02386"
FT                   /protein_id="ACV61232.1"
FT                   /translation="MLDLNNFDRIRIGLASPEQIREWSSGEVKKPETINYRTLKPERDG
FT                   LFCERIFGPTRDWECHCGKYKRVRYKGVVCDRCGVEVTRSKVRRERLGHIELAAPVSHI
FT                   WYFKGIPSRMGLLLDMSPRALEKVLYFVSYIVTDQGNTTLIKKQLLTETEYRDNKEKFG
FT                   NEFHAGMGAEAIKILLEEINLNEMSRELRAELKEVTGQRKIRAIRRLEVVEAFKKSGNR
FT                   PEWMIMDVVPVIPPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPDIIV
FT                   RNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSDMLKGKQGRFRQNLLGKRVDYSG
FT                   RSVIVVGPRLQLHQCGLPKEMALELFKPFVMKRLVNEGCAHNIKSAKRMVERVRSEVWD
FT                   VLEDVIKEHPVLLNRAPTLHRLGIQAFEPILVEGKAIQIHPMVCTAYNADFDGDQMAVH
FT                   VPLSAEAQAEARLLMLSANNILNPKDGKPVAIPTQDMVLGCYYLTVEKKGDFGEGKAFK
FT                   DEDEAIMAYYNKACSLHARIRVRRSDGKLLSTTIGRLIFNAVIPEELGYINKVVDKKVS
FT                   SKIVDDCYRKLGYAATANLLDGIKTLGYEFATRAGVTVGVADVTIPEAKKEILLESEQK
FT                   VRDIERQYRRGLITEDERYRQVINIWNSATDRVTKALMTSLDKFNPVYMMATSGARGNI
FT                   QQIRQLAGMRGLMADPSGRIIDLPIKANFREGLTVLEYFISTHGARKGLADTALRTADS
FT                   GYLTRRLVDVSQDVIVREVDCGTAEGIEVGEVRDGTEIIEKIEDRIEGRVLVEDIIDPR
FT                   TGEILVACRNEDGTPHEVSREDTERIKDVNERESNEEIQKKVESIKIRSVLTCKSRYGV
FT                   CINCYGRNLATGRKVDIGEAVGIIAAQSIGEPGTQLTMRTFHTGGVAGDDITQGLPRVE
FT                   ELFEARRPKGQAVVTEITGNVEIREVKGRREIEVTAVDSGEATVYAVPFGARIKVRDGQ
FT                   RVEAGDALTEGSVNPHDLLKIKGTRGVQVYLLQEVQRVYGLQGVDINDKHIEVMIRQML
FT                   RKVKVEEQGDTSLLPGGLIDIFEFEEENSAVIAEGGEPATARAVLLGITKASLATDSFL
FT                   SAASFQETTRVLTEAAIKGKLDPLLGLKENVIIGKLVPAGTGMSRYRNIELLSGNNDQD
FT                   DAGVMDERQ"
     ttgctggatc ttaataattt tgatcgtatt cggattggat tggcatcccc tgaacagatt        60
     cgcgagtggt caagcggtga ggttaagaaa cctgagacta tcaattaccg gacattaaaa       120
     ccggaaagag atggcttgtt ttgtgaacgt atttttggac ccaccaggga ttgggaatgt       180
     cattgcggca agtacaaaag ggttcgttat aaaggagtgg tttgtgatcg ttgcggtgtg       240
     gaagtgactc gttccaaggt gcgtagagaa agattgggac atattgaact ggctgcgccg       300
     gtatcgcata tttggtactt taaaggtata cccagtcgaa tgggtttact gttggatatg       360
     tctcctcgcg ctctggaaaa agtattgtac tttgtctcct atatcgtaac tgatcagggt       420
     aatactactc ttattaaaaa gcagctgtta actgaaacgg aatatcgtga taataaggaa       480
     aagttcggca acgagtttca tgccggcatg ggtgccgaag cgattaagat tcttttggaa       540
     gaaataaatt tgaatgagat gagcagggag ctccgtgctg aactaaagga agttacaggg       600
     cagcgaaaga taagagcaat tcgtcggctg gaagttgtcg aagcttttaa gaaatccggc       660
     aatcggccgg aatggatgat tatggatgtg gttcctgtta ttccgcctga actaaggcca       720
     atggtgcaat tagacggggg gaggtttgcc acctcggatt taaatgattt gtaccgtcgt       780
     gtgattaacc ggaacaaccg tttaaagaga ctgctggatt tgggtgcacc ggatatcata       840
     gttcgtaatg aaaagagaat gctccaggaa gcagtggatg ctttaattga taatggccgg       900
     cgaggccggc cggtaacagg tccgggcaac cgtcctttga aatccttaag cgacatgctg       960
     aaaggcaagc agggcaggtt cagacagaac ctgctgggta agagggtaga ctattcgggt      1020
     cgctcggtta ttgtagttgg tccccgcctg cagttgcacc agtgtggttt gcccaaagag      1080
     atggcgctgg aattatttaa accttttgta atgaaaagat tggtgaacga gggttgcgcg      1140
     cataatataa aaagcgccaa gcgtatggtt gagcgggttc gttcagaagt ttgggacgtt      1200
     ctggaagatg ttattaagga gcacccggtc ctgttaaacc gtgccccgac tttgcaccgt      1260
     ttaggaattc aggctttcga accgatttta gtagagggta aagctattca gattcacccg      1320
     atggtgtgta ctgcctataa tgctgatttt gacggcgacc agatggctgt gcacgtgcct      1380
     ctttccgcgg aagcccaggc tgaggcgaga ttgttaatgc tttctgccaa taatatttta      1440
     aatcctaagg atggaaaacc ggttgcaatc ccaacgcagg acatggtgct cggttgttac      1500
     tatctcacgg tagagaaaaa aggtgatttt ggggaaggta aagcctttaa ggatgaagat      1560
     gaagctatta tggcttatta caataaggcc tgcagcctac acgccagaat cagagtgagg      1620
     cgttccgacg gcaagcttct ttccacaact attggcaggc taatttttaa tgcggttatt      1680
     ccagaagaat tgggctatat taataaagta gttgacaaaa aggtctccag caaaatagta      1740
     gatgattgtt accgcaagct gggctacgct gctactgcta atctactgga cggcatcaag      1800
     acacttgggt atgagtttgc taccagggcc ggtgtgacag ttggtgtggc tgacgtaact      1860
     atacctgagg ccaagaaaga aatattgctc gaatccgaac agaaggttcg cgatattgag      1920
     aggcagtaca ggcgtggttt gattactgag gatgagagat accggcaagt gatcaatatt      1980
     tggaacagcg ccactgaccg ggtgactaaa gctctgatga cttccttgga taagtttaat      2040
     cccgtgtaca tgatggccac ctccggggcc cgcggtaata tccagcagat tcgacagtta      2100
     gccggtatga gaggcttgat ggctgatcct tcgggcagga ttattgactt accgattaag      2160
     gctaatttcc gtgaaggtct tactgttttg gagtacttca tttccacgca cggtgccaga      2220
     aaaggattgg ccgatacagc tctcaggacc gctgattcag gatacttgac caggcgttta      2280
     gttgatgttt cgcaggacgt catagtaaga gaagtagatt gcggcaccgc ggaaggcatc      2340
     gaagtgggtg aggtcaggga cggtacggaa attattgaga agattgagga tcgtattgag      2400
     ggcagagtac ttgtagagga tattattgat ccaagaaccg gagaaatact cgtggcctgc      2460
     cgaaatgagg atggaactcc ccatgaggtt agcagagaag atacagagcg aataaaagat      2520
     gtcaacgaaa gagagagcaa tgaagaaata cagaaaaagg ttgaaagcat taaaattcgt      2580
     tcggtcttaa cctgcaaaag caggtacgga gtttgcatta actgctatgg ccgcaacctg      2640
     gctaccggga gaaaggtgga tatcggagaa gcggtaggta ttattgccgc tcagtctatc      2700
     ggtgaacctg gtacacagct tactatgcgt accttccata ccgggggtgt ggcaggagat      2760
     gatataactc aaggtttgcc gagggtagaa gaattatttg aagccagacg gcccaaaggc      2820
     caggctgtgg taactgaaat aaccggtaac gtggaaatta gggaagtaaa aggacgccgt      2880
     gagattgagg taacggctgt cgattccggc gaggctacag tttatgccgt tccttttgga      2940
     gctcgcatta aagttaggga tggtcagagg gtagaagcgg gagatgccct gaccgaaggc      3000
     tcggtaaatc cacatgactt gcttaaaatt aaagggacgc ggggggtaca agtgtacctg      3060
     ctgcaggaag ttcagcgagt atacggtttg cagggcgttg acattaatga taaacacata      3120
     gaagtgatga tcaggcagat gctgcgcaaa gtaaaggttg aggaacaggg tgacacctca      3180
     ttgctgccgg gaggtttgat tgatatcttt gaatttgagg aagagaatag cgctgtgata      3240
     gctgaaggtg gcgaacctgc cacggccaga gccgtgctct taggtatcac caaggcttcc      3300
     ttggctaccg actccttctt gtcagccgcc tcattccagg aaaccaccag agtgctgact      3360
     gaggctgcta taaaaggcaa gctggatccc ctgttaggct tgaaggaaaa cgttattatc      3420
     ggtaaattgg tgcccgccgg cacaggtatg tctcgttacc gtaacatcga actgctgtca      3480
     ggtaacaatg accaggatga tgccggtgtt atggatgaga ggcaatag                   3528
//

If you have problems or comments...

PBIL Back to PBIL home page