(data stored in ACNUC7421 zone)

EMBL: CP001720.PE269

CP001720.PE269       Location/Qualifiers
FT   CDS_pept        308314..308688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0281"
FT                   /product="ribosomal protein S12"
FT                   /note="TIGRFAM: ribosomal protein S12; PFAM: ribosomal
FT                   protein S12/S23; KEGG: geo:Geob_3630 ribosomal protein S12"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61234"
FT                   /db_xref="GOA:C8W3Y0"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3Y0"
FT                   /inference="protein motif:TFAM:TIGR00981"
FT                   /protein_id="ACV61234.1"
FT                   /translation="MPTINQLVHKGRSSLITKSTAPALKECPQKRGVCTRVYTTTPKKP
FT                   NSALRKVARVRLTNGIEVTSYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGALDT
FT                   AGVQNRNRSRSKYGTKRPKK"
     gtgccgacta ttaaccaatt ggtgcataaa gggagaagca gtcttataac caagtcaact        60
     gcccccgcac tgaaggaatg tccccaaaaa cggggagtat gtactagagt gtacactaca       120
     acacctaaaa aaccaaactc tgcattgcgt aaagttgcca gggtaaggtt gaccaatggc       180
     attgaggtta cttcctatat tcccggcatt ggtcataacc tgcaggagca ctcggtggtt       240
     cttgtcaggg gaggaagggt aaaagacctg ccaggtgtcc gttatcatat tgtgcgcgga       300
     gctttggaca cagccggtgt tcaaaatagg aacagaagtc gttccaagta tggtaccaag       360
     cgaccgaaaa aatag                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page