(data stored in ACNUC7421 zone)

EMBL: CP001720.PE27

CP001720.PE27        Location/Qualifiers
FT   CDS_pept        30609..31715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0028"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: dat:HRM2_15240 BioB2"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACV60992"
FT                   /db_xref="GOA:C8VVC9"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023891"
FT                   /db_xref="InterPro:IPR034422"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVC9"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ACV60992.1"
FT                   /translation="MVTINLEAIIDKALNRNTLSKEEIKFLLKLSDPLMKEKVFLTARE
FT                   LRNRYFQDRVFLYGFIYFSTYCRNDCSFCYYRKSNNLCRRYRKTAAEVADIARALAESG
FT                   VYLIDLTMGEDPLYLSDSTEGQEKLLEIVRMVKESTGLPVMISPGVVAAGMLKKLKEAG
FT                   ADWYACYQETHNRRLYKKLRLNQSYNERWAIKVYAKTIGMLVEEGLLVGVGDSIDDIVN
FT                   SLMEMKSLGAEQVRTMTFVPQQGTPLYGIDAPGDALELNIIAVMRILFPDRLIPASLDV
FT                   KGIFGLKERLDAGANVVTSLIPPERGLVGVSQSTLDISEGHRTVKGIMPALQSCGLKPA
FT                   TLAEYTKWIKEKQGHPIKIDKRKEMLCW"
     atggttacta taaatcttga agcaattatc gacaaggcct tgaaccgaaa tactctttca        60
     aaagaagaaa ttaaatttct tcttaagctg tctgaccctc tgatgaagga aaaagttttt       120
     ctaacagcca gggaattgcg caacagatat tttcaggatc gggttttcct atatggattt       180
     atttatttct ctacttattg caggaatgat tgcagctttt gctattatcg caaatccaat       240
     aacttgtgcc ggaggtatcg caagacggca gcggaagttg ctgatatcgc ccgtgccctg       300
     gctgagtcag gagtatatct cattgattta accatgggtg aggatcccct gtacctttca       360
     gacagtacgg agggacagga gaaactgttg gaaattgtta gaatggtgaa agaaagtaca       420
     ggtttgccgg ttatgatatc tcctggtgtt gtagcggccg gcatgttaaa aaaattaaaa       480
     gaggccgggg ccgattggta tgcctgctat caggaaactc ataaccggcg gttgtataaa       540
     aaactaagac taaaccagag ctataatgaa agatgggcta taaaggtata tgcaaaaact       600
     atcggcatgc tggtagaaga aggtctattg gttggtgtgg gggacagcat tgacgatatt       660
     gttaattctt taatggaaat gaaaagcctg ggggcggagc aggtcaggac gatgactttc       720
     gtaccccagc aaggtactcc gctgtatgga atagatgcgc ctggtgacgc tctggagctt       780
     aatattattg ccgttatgcg tatcctattt ccggataggc tgattcctgc ttctctggat       840
     gttaagggta tatttggctt gaaagagcgt cttgatgcag gagcaaatgt tgttacttct       900
     ttgattccgc ctgagcgggg attggttgga gtttcacaga gcacgctgga tatctctgag       960
     gggcacagaa cggttaaagg gatcatgccg gctttgcagt cctgcgggtt gaagccggcg      1020
     actcttgctg aatataccaa atggataaaa gaaaaacagg gccatccgat aaaaattgat      1080
     aaaaggaagg aaatgctgtg ctggtag                                          1107
//

If you have problems or comments...

PBIL Back to PBIL home page