(data stored in ACNUC7421 zone)

EMBL: CP001720.PE272

CP001720.PE272       Location/Qualifiers
FT   CDS_pept        311554..312756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0284"
FT                   /product="translation elongation factor Tu"
FT                   /note="TIGRFAM: translation elongation factor Tu; small
FT                   GTP-binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor Tu domain protein;
FT                   elongation factor Tu domain 2 protein; KEGG: bsu:BSU01130
FT                   elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61237"
FT                   /db_xref="GOA:C8W3Y3"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3Y3"
FT                   /inference="protein motif:TFAM:TIGR00485"
FT                   /protein_id="ACV61237.1"
FT                   /translation="MAKAKFERTKPHVNIGTIGHVDHGKTTLTAAITVCLATVGQATVK
FT                   KYDEIDNAPEERERGITINTAHVEYETSQRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VVSAADGPMPQTREHILLSRQVGVPYIVVFLNKADMVDDPELLELVDMEVRELLSMYEF
FT                   PGDDTPIIAGSGLKALECACGKRECEWCGKVWELMDAVDEYIPTPMRDKDKPFLMPVED
FT                   VFTITGRGTVATGRVERGQVKIGDAIEIVGLQDEPRKTVVTGVEMFRKLLDYAEAGDNV
FT                   GCLLRGVDRKEIERGQVLAKPGSIKPHTKFNAEVYVLSKEEGGRHTPFFNGYRPQFYFR
FT                   TTDVTGIVKLPEGVEMVMPGDNIKVDIDLITPIAIEEGLRFAIREGGRTVGAGVVTGIN
FT                   A"
     atggcaaaag caaaatttga gcggactaaa ccgcacgtta acattggcac aatcggtcac        60
     gtagaccacg gcaagaccac attgacagcg gcaataaccg tatgtttagc tacagtaggc       120
     caggctacag ttaagaaata tgacgaaatc gataatgctc ccgaagaaag agaacgcggc       180
     atcaccatca acacagcgca cgtagaatat gaaaccagcc agcgccacta tgcgcacgta       240
     gattgcccgg gacacgccga ctatgtaaag aacatgatta ccggagcagc gcaaatggac       300
     ggagcaatcc tggtagtgtc agcggcggac ggcccgatgc cgcagaccag agaacacatc       360
     ctcttatcca gacaggtagg tgtgccctat atcgtagtat tcctgaacaa ggctgacatg       420
     gtagatgatc ctgaactgtt ggaactggta gatatggaag taagagagct tctttccatg       480
     tatgaatttc ccggagatga tacaccgatc atcgcaggtt ccggcttaaa agcattagaa       540
     tgtgcctgtg gcaaaagaga atgcgaatgg tgcggcaaag tatgggaact gatggatgcg       600
     gtagatgaat acattcccac cccgatgcgc gataaagata agcctttctt aatgccggta       660
     gaagacgtat tcaccattac cggacgcggt acagtggcca cgggaagagt ggagcgcggc       720
     caggtgaaaa tcggtgatgc catagaaatc gttggtttgc aggatgagcc gagaaagaca       780
     gtagtaaccg gcgtagaaat gttccgcaaa ttgctcgact acgcagaagc gggtgacaac       840
     gtaggttgtt tattgcgcgg tgtggacaga aaagaaatcg aacgcggtca agtactggct       900
     aagccgggca gcatcaagcc ccacaccaag tttaacgcgg aagtgtatgt gcttagtaaa       960
     gaagagggtg gccgccatac tccgtttttc aacggctaca gacctcagtt ttatttccgt      1020
     accactgatg tgaccggtat tgtgaaactt ccggaaggcg tagagatggt aatgccggga      1080
     gacaatatca aggtggatat tgatttgatt acgccgattg ctattgaaga aggcttgcgc      1140
     tttgctattc gtgaaggcgg cagaaccgta ggcgccggtg ttgttaccgg tatcaatgcg      1200
     taa                                                                    1203
//

If you have problems or comments...

PBIL Back to PBIL home page