(data stored in ACNUC7421 zone)

EMBL: CP001720.PE273

CP001720.PE273       Location/Qualifiers
FT   CDS_pept        312867..313175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0285"
FT                   /product="ribosomal protein S10"
FT                   /note="TIGRFAM: ribosomal protein S10; PFAM: ribosomal
FT                   protein S10; KEGG: bha:BH0133 30S ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61238"
FT                   /db_xref="GOA:C8W3Y4"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3Y4"
FT                   /inference="protein motif:TFAM:TIGR01049"
FT                   /protein_id="ACV61238.1"
FT                   /translation="MKNQKIRIRLKAYDHFMLDQSAKKIVETAKRTGAQVAGPIPLPTE
FT                   KNIYTILRSPHVNKDSREQFEMRTHKRLIDILEPTPKTVDSLMRLDLPAGVDIEIKL"
     atgaagaatc aaaaaatccg gatcaggttg aaggcgtacg accactttat gctggatcaa        60
     tctgccaaga agattgttga aacagctaag agaaccggcg cacaagtagc agggcctatt       120
     cccctgccga cagaaaaaaa tatatatact attctgcgct cacctcatgt aaacaaagat       180
     tcccgtgagc agtttgagat gagaacgcat aagagattaa ttgatatttt ggaacccacc       240
     cctaaaacag tagattcctt gatgcgcctg gatttacctg ccggtgtgga cattgagatt       300
     aaattataa                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page