(data stored in ACNUC7421 zone)

EMBL: CP001720.PE275

CP001720.PE275       Location/Qualifiers
FT   CDS_pept        313886..314506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0287"
FT                   /product="ribosomal protein L4/L1e"
FT                   /note="PFAM: ribosomal protein L4/L1e; KEGG: bha:BH0135 50S
FT                   ribosomal protein L4"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61240"
FT                   /db_xref="GOA:C8W3Y6"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3Y6"
FT                   /inference="protein motif:PFAM:PF00573"
FT                   /protein_id="ACV61240.1"
FT                   /translation="MPTVALFNIKGEQVGEVALKDEVFGIEVNESVLHDAVVMQLAGRR
FT                   QGTHDTKTRGEVRGGGKKPWRQKGTGRARHGTIRSPIWRGGGIVFGPHPRTYKYKLPKK
FT                   VRRLALKSALSSKVLAGNIKVLDALSMEMPKTKEMVGILKNLQVDKALLVIADKDMNVI
FT                   KSARNIPGIKPVGAAGVNVYDLLKHTTLVITKDAVSKVEEVLS"
     atgcctacag tagcactgtt taatataaag ggtgagcagg tcggcgaagt agctttaaag        60
     gatgaagtat ttggcataga agttaatgaa tctgtactgc atgatgcagt ggtcatgcaa       120
     ttggcaggcc gacgtcaggg aacccatgat acaaagacca gaggcgaagt acgtggcggt       180
     ggtaaaaaac cttggcgcca gaagggaaca ggacgtgcca ggcacggtac aatacgttca       240
     cccatatggc ggggcggtgg gattgtgttt ggaccccatc ccagaactta taaatataaa       300
     ttacctaaaa aagttcgccg cttagcttta aagtcagctt tatcctctaa ggttttggct       360
     ggcaatatca aagttttgga tgccttaagt atggaaatgc caaaaaccaa agagatggtg       420
     ggcattttga aaaacctgca ggtggataaa gcattgttgg taattgctga taaagatatg       480
     aatgttatta agtcagcccg taatattcca ggcattaagc cggtgggagc agcaggcgta       540
     aacgtatatg accttttaaa gcatactact ttggttataa ccaaggatgc ggtgtccaaa       600
     gtagaggagg tgctgtcata a                                                 621
//

If you have problems or comments...

PBIL Back to PBIL home page