(data stored in ACNUC7421 zone)

EMBL: CP001720.PE278

CP001720.PE278       Location/Qualifiers
FT   CDS_pept        315691..315975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0290"
FT                   /product="ribosomal protein S19"
FT                   /note="TIGRFAM: ribosomal protein S19; PFAM: ribosomal
FT                   protein S19/S15; KEGG: bha:BH0138 30S ribosomal protein
FT                   S19"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61243"
FT                   /db_xref="GOA:C8W3Y9"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3Y9"
FT                   /inference="protein motif:TFAM:TIGR01050"
FT                   /protein_id="ACV61243.1"
FT                   /translation="MGRSLKKGPYCEERLLSRIEKMNETGDKKVIKTWSRRSTIFPQMI
FT                   GHTIAVHDGRKHVPVYVTEDMVGHKLGEFSPTRTFRGHGSHTERSTSLK"
     atgggtcgct ccttgaaaaa gggaccttat tgtgaagaac ggctgttatc taggattgaa        60
     aagatgaacg aaaccggtga caagaaagtt atcaaaacat ggtcccgtcg ttccacaatt       120
     ttcccgcaga tgatcggtca tacaatagca gtgcatgacg ggagaaagca tgtgcctgta       180
     tatgtaactg aagatatggt tggtcacaaa cttggggaat tctcaccaac cagaacattc       240
     agaggacacg gatcacacac cgaaagatct acatcattga aatag                       285
//

If you have problems or comments...

PBIL Back to PBIL home page