(data stored in ACNUC7421 zone)

EMBL: CP001720.PE28

CP001720.PE28        Location/Qualifiers
FT   CDS_pept        31706..32866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0029"
FT                   /product="protein of unknown function DUF201"
FT                   /note="PFAM: protein of unknown function DUF201; KEGG:
FT                   abu:Abu_2250 ATP-grasp domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACV60993"
FT                   /db_xref="GOA:C8VVD0"
FT                   /db_xref="InterPro:IPR003806"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR023890"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVD0"
FT                   /inference="protein motif:PFAM:PF02655"
FT                   /protein_id="ACV60993.1"
FT                   /translation="MLVAIMGGKLQGVEAAYLSRQAGWKAVLVDRNRDAPAAGMCDNFI
FT                   QADLMEKDKLVDLFKKVKLVIPAVENSEVLENIKECALAAGVKIIYDSAAYALSSSKIE
FT                   SDKLFARLDLPVPKPWSGCGFPVVIKPSGASGSENVYKINSLRDFNELTLKLGNLDSWV
FT                   KQEYLRGPSYSIEVIGCKGDYQTFQITELEMDAAHDCKRVLAPAQLSTEKQDEFKSQAV
FT                   KIARALNLNGIMDVEVILHDEKFKVLEIDARLPSQTPTVVYKATGINMLEVLWPGGLKR
FT                   REKQEIGMTRGVVYEHIKVRSNRLIEVGGEHIMAGAGRLHILKKFFGADEAISNYDRDK
FT                   TEWVATLIITGKNRQEAWLKRTAVIKNIMQEFAVEDCMDTGISNKG"
     gtgctggtag caataatggg tggaaagctg cagggcgtgg aagcggccta tctttcccgg        60
     caagccggat ggaaagcagt gctggttgac aggaatcggg acgctccggc tgccgggatg       120
     tgcgataact ttatccaagc tgatcttatg gagaaagata aattagttga tttatttaag       180
     aaagttaaac tggttattcc ggctgtggaa aacagtgagg tactggaaaa tatcaaagaa       240
     tgtgcccttg cggcaggtgt gaaaattatt tatgattctg ctgcctatgc tctttcttcc       300
     tccaaaatag agtcggataa actctttgca aggcttgatc tgcctgttcc gaagccctgg       360
     tccggctgtg gctttcctgt tgtcataaag ccctccggag caagcggcag tgaaaatgtt       420
     tataagatta acagtctcag agattttaac gagcttacct tgaagctggg taatctggat       480
     agttgggtca aacaggaata tctgcggggt ccctcctact cgattgaagt tataggctgc       540
     aagggggatt atcagacttt ccagataaca gaattagaaa tggacgccgc tcatgattgt       600
     aaaagagtat tggctcctgc gcaattatcc acggaaaagc aggatgaatt taaatctcag       660
     gctgttaaaa tagcccgggc tctcaacttg aatggaatta tggatgtcga agtcattttg       720
     catgatgaaa agtttaaagt actggaaata gacgcccgct tgccaagcca gactccaacc       780
     gtagtttata aagccacggg tattaatatg ctggaagttt tatggcccgg tggcttaaaa       840
     agaagggaga agcaagaaat aggaatgacc aggggcgttg tttatgaaca tattaaagta       900
     agaagcaacc ggctgattga agttggcgga gagcatataa tggcgggagc cggtcgcctg       960
     catatcttaa aaaagttttt tggtgcagac gaagctattt caaattatga cagggataaa      1020
     acagaatggg ttgctactct cattattaca ggtaagaaca ggcaggaggc ttggttaaaa      1080
     agaacggcag ttataaagaa tatcatgcaa gagtttgctg ttgaggattg catggatacc      1140
     ggcatttcaa ataaaggatg a                                                1161
//

If you have problems or comments...

PBIL Back to PBIL home page