(data stored in ACNUC7421 zone)

EMBL: CP001720.PE283

CP001720.PE283       Location/Qualifiers
FT   CDS_pept        317676..317939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0295"
FT                   /product="ribosomal protein S17"
FT                   /note="PFAM: ribosomal protein S17; KEGG: gme:Gmet_0635 30S
FT                   ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61248"
FT                   /db_xref="GOA:C8W3Z4"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3Z4"
FT                   /inference="protein motif:PFAM:PF00366"
FT                   /protein_id="ACV61248.1"
FT                   /translation="MEERNNRKIRVGRVVSNKMDKTVVVSVETITPHKLYNKTIRTSKK
FT                   FKAHDEENSCRTGDTVRIMETRPLSKEKRWRVIEILERGKQI"
     atggaagaac gtaacaaccg caagattcgt gtgggccggg ttgttagtaa taaaatggat        60
     aaaacagttg tagtatcggt tgaaacaata acaccgcata agctgtataa taaaaccata       120
     cgaacatcaa aaaaatttaa agcccatgac gaggaaaaca gttgccggac gggtgatact       180
     gttcgtatca tggaaacaag accactctct aaggaaaaga gatggagagt tatagagata       240
     ttggaaagag gcaagcagat ttaa                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page