(data stored in ACNUC7421 zone)

EMBL: CP001720.PE284

CP001720.PE284       Location/Qualifiers
FT   CDS_pept        317983..318351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0296"
FT                   /product="ribosomal protein L14"
FT                   /note="TIGRFAM: ribosomal protein L14; PFAM: ribosomal
FT                   protein L14b/L23e; KEGG: bha:BH0144 50S ribosomal protein
FT                   L14"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61249"
FT                   /db_xref="GOA:C8W3Z5"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3Z5"
FT                   /inference="protein motif:TFAM:TIGR01067"
FT                   /protein_id="ACV61249.1"
FT                   /translation="MIQAETRLNVADNTGARKLLCIRVLGGAHRKYARIGDTIVCSVKE
FT                   ATPGGVVKKGDVVKAVVVRTKKELRRNDGTYIKFDENAAVIIKDDKSPRGTRIFGPVAR
FT                   ELRDKDYMKIVSLAPEVI"
     gtgattcaag ctgaaaccag gcttaatgta gcagataaca cgggagcgcg caaactgctt        60
     tgtatccgcg tactgggcgg tgctcatcgt aaatatgcca gaataggtga cacgatagtt       120
     tgttctgtta aagaagctac acctggcggc gttgttaaga aaggcgatgt ggttaaagct       180
     gtcgtggttc gcactaaaaa agaactaagg cggaacgacg gaacctatat caagtttgat       240
     gaaaatgccg ctgtaattat taaagatgat aaaagtcctc gtgggacacg tatttttgga       300
     cctgtagcca gagagctcag agataaggat tatatgaaaa ttgtttcact ggcacccgag       360
     gtaatttaa                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page