(data stored in ACNUC7421 zone)

EMBL: CP001720.PE286

CP001720.PE286       Location/Qualifiers
FT   CDS_pept        318762..319304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0298"
FT                   /product="ribosomal protein L5"
FT                   /note="PFAM: ribosomal protein L5; KEGG: bha:BH0146 50S
FT                   ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61251"
FT                   /db_xref="GOA:C8W3Z7"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3Z7"
FT                   /inference="protein motif:PFAM:PF00281"
FT                   /protein_id="ACV61251.1"
FT                   /translation="MVRLKDKYNNEIVSAMQNKFGYKNIMEVPKLEKVVVNMGVGEAAQ
FT                   NSKAIDAAVGDMVKITGQKPIVTKAKKSIAAFKLRAGMPIGCKTTLRGERMYEFADKLV
FT                   SIVLPRVRDFRGVSPKSFDGRGNYTLGLREQIIFPEIEYDKVDKIRGMDIIFVTTAKTD
FT                   EEGRELLRLMGMPFKAN"
     ttggtcaggt tgaaggataa gtataataat gaaattgtat cagcaatgca aaataaattc        60
     ggctataaaa atattatgga agttcccaag ctggagaagg tagtagtcaa tatgggtgta       120
     ggtgaggcag cccagaattc aaaagcgatt gatgccgctg ttggagatat ggttaagatt       180
     acagggcaga agccgatagt taccaaggct aaaaaatcta tcgcggcttt taaattgcgt       240
     gccggtatgc cgataggctg caagactact ttacgaggcg agcgcatgta cgaatttgcg       300
     gacaaattag tcagtattgt tttgcccaga gtcagggatt ttcgcggggt atctcccaaa       360
     tcttttgacg gcaggggcaa ctatacatta ggcttgcgcg agcagattat ctttccggaa       420
     attgaatatg ataaggttga caaaataaga ggtatggaca ttatatttgt taccacggcc       480
     aaaactgatg aagagggacg tgagctctta cgtctcatgg gcatgccttt taaggccaac       540
     taa                                                                     543
//

If you have problems or comments...

PBIL Back to PBIL home page