(data stored in ACNUC7421 zone)

EMBL: CP001720.PE288

CP001720.PE288       Location/Qualifiers
FT   CDS_pept        319540..319938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0300"
FT                   /product="ribosomal protein S8"
FT                   /note="PFAM: ribosomal protein S8; KEGG: bha:BH0148 30S
FT                   ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61253"
FT                   /db_xref="GOA:C8W3Z9"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3Z9"
FT                   /inference="protein motif:PFAM:PF00410"
FT                   /protein_id="ACV61253.1"
FT                   /translation="MVMTDPISDFLTRIRNANMVFHDKVEAPASKVKRAIANILKEEGF
FT                   VRDVEYIEDGKQGIVRVYLKYGTTKERVITGLKRISKPGLRVYARKDQVPRVLGGLGIA
FT                   IISTSNGIMTDKKARKQGLGGEVVCYIW"
     atggttatga ccgatccgat ttccgatttc ttgacacgta ttcgcaatgc taatatggtt        60
     ttccacgata aagtggaagc acccgcatcg aaggtaaaac gtgctatcgc caatattctg       120
     aaagaagaag gctttgtcag agatgttgag tatattgagg acggaaaaca gggaatagtt       180
     cgggtttatt taaaatacgg aacaaccaaa gaaagagtta taaccggttt gaagagaatc       240
     agcaagcctg gcttaagggt atatgccaga aaagatcagg ttcccagagt tttaggtggt       300
     cttggtattg ctattatttc cacttcgaat ggtataatga ccgataaaaa agcaagaaaa       360
     caaggtttag gcggagaagt cgtttgttat atctggtag                              399
//

If you have problems or comments...

PBIL Back to PBIL home page