(data stored in ACNUC7421 zone)

EMBL: CP001720.PE292

CP001720.PE292       Location/Qualifiers
FT   CDS_pept        321455..321634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0304"
FT                   /product="ribosomal protein L30"
FT                   /note="TIGRFAM: ribosomal protein L30; PFAM: ribosomal
FT                   protein L30; KEGG: baa:BA_0711 ribosomal protein L30p/L7e"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61257"
FT                   /db_xref="GOA:C8W403"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/TrEMBL:C8W403"
FT                   /inference="protein motif:TFAM:TIGR01308"
FT                   /protein_id="ACV61257.1"
FT                   /translation="MADLKITLVRSCIGRPQKQRDNVRALGLRKLNSSVVKKDTPIVRG
FT                   MINKVSHLLKIEEV"
     gtggccgact taaagattac cttggtcaga agttgcatcg gcaggcctca gaaacagcgg        60
     gacaacgtga gagcccttgg tttgaggaag ctgaacagta gtgtagtaaa aaaagataca       120
     cctatcgtac gaggtatgat taataaggtt tcccatttat taaagattga agaagtatag       180
//

If you have problems or comments...

PBIL Back to PBIL home page