(data stored in ACNUC7421 zone)

EMBL: CP001720.PE293

CP001720.PE293       Location/Qualifiers
FT   CDS_pept        321647..322087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0305"
FT                   /product="ribosomal protein L15"
FT                   /note="TIGRFAM: ribosomal protein L15; PFAM: ribosomal
FT                   protein L15; KEGG: bha:BH0153 50S ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61258"
FT                   /db_xref="GOA:C8W404"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/TrEMBL:C8W404"
FT                   /inference="protein motif:TFAM:TIGR01071"
FT                   /protein_id="ACV61258.1"
FT                   /translation="MFLHEIKPNPGARKEPKRKGQGIGSGNGKTAGRGHKGQNARSGGG
FT                   VRPGFEGGQMPLQRRLPKRGFNNIFAKEIAAINVDDLNRFENGETITPEMLKECRLIRK
FT                   FKDGVKILGHGELKKSLTVQANAFSKAAVEKIEAAGGKAEVI"
     ttgtttttac atgaaataaa gcctaacccc ggcgccagaa aagaacctaa gcgcaaaggg        60
     cagggcatag gttccggtaa cggaaagact gccgggcgcg gacacaaagg acagaacgcc       120
     cgttccggcg gtggtgtaag gcccggtttt gaaggtggtc aaatgccttt acagcgtcgc       180
     ctgcctaaaa gaggttttaa taatattttt gctaaagaaa ttgccgctat caatgtagac       240
     gatttgaacc gttttgaaaa cggtgaaaca ataacacctg aaatgttaaa agagtgccgg       300
     ctgatcagaa aatttaagga cggcgtaaaa atattggggc atggagaatt aaaaaagtca       360
     cttactgtac aggcaaatgc ttttagtaaa gctgctgttg agaagattga ggcagccggc       420
     ggcaaagcag aggtgattta a                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page